(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE14

CAGLA1_12.PE14       Location/Qualifiers
FT   CDS             complement(55412..55675)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044075"
FT                   /gene_name="TIM8"
FT                   /locus_tag="CAGL0M00418g"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM8"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAG62339.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG163129"
FT                   /db_xref="HOGENOM:HBG603145"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI00003B6FEE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK81"
FT                   /transl_table=1
FT                   /translation="MSNLNPGELGDLTDASKKEIAAYLDAENSKQKVRTSINQFTDICF
FT                   KKCISRVDNGNLSSQEEECLASCVNRFLDTNIRVVRGLQNSQ"
     MSNLNPGELG DLTDASKKEI AAYLDAENSK QKVRTSINQF TDICFKKCIS RVDNGNLSSQ        60
     EEECLASCVN RFLDTNIRVV RGLQNSQ                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page