(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE140

CAGLA1_12.PE140      Location/Qualifiers
FT   CDS             complement(374158..374958)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000837" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348983"
FT                   /locus_tag="CAGL0M03267g"
FT                   /product="Similar to uniprot|P38632 Saccharomyces
FT                   cerevisiae YEL019c MMS2 DNA repair protein "
FT                   /protein_id="CAG62465.1"
FT                   /db_xref="HOGENOM:HBG124038"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00003B706A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJV5"
FT                   /transl_table=1
FT                   /translation="MDSVALPEALPIHKDQRDNFHDLRECYISSELSTIEKQYEKTINQ
FT                   LTTYIDLLEEDQILQCVNKLTESYKDTLAQKEQADQLDNQLESLKQDYLRISDHSPATD
FT                   IDSFREYTNGTVGIDSFQKYFTEGIVDQKPTIPRNNVRRKPNTYEKLLKALPYIIRDPT
FT                   CVIPDEDQEEDDIQIEGGKIELNCPITCKPFENPMISKACNHVFDKVGIQMYFDTPDKK
FT                   KCPQGACGHELTARDFIPDNIMMLRCKINNRKKNDQARNMLDVL"
     MDSVALPEAL PIHKDQRDNF HDLRECYISS ELSTIEKQYE KTINQLTTYI DLLEEDQILQ        60
     CVNKLTESYK DTLAQKEQAD QLDNQLESLK QDYLRISDHS PATDIDSFRE YTNGTVGIDS       120
     FQKYFTEGIV DQKPTIPRNN VRRKPNTYEK LLKALPYIIR DPTCVIPDED QEEDDIQIEG       180
     GKIELNCPIT CKPFENPMIS KACNHVFDKV GIQMYFDTPD KKKCPQGACG HELTARDFIP       240
     DNIMMLRCKI NNRKKNDQAR NMLDVL                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page