(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE141

CAGLA1_12.PE141      Location/Qualifiers
FT   CDS             375233..375850
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501143"
FT                   /gene_name="EAF5"
FT                   /locus_tag="CAGL0M03289g"
FT                   /product="Chromatin modification-related protein EAF5 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62466.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124039"
FT                   /db_xref="UniParc:UPI00003B706B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV4"
FT                   /transl_table=1
FT                   /translation="MNEEIQTLLIYQICDSLRFQANMEDISVDDVMDVMQENIMVECLL
FT                   DGVIMDKADVQKIVIQYVTDGELGEEAIGDKMESMYSNSRKKLLKEIDDLDNTISTNRK
FT                   KDKLLNLYRDTVLNRLQNKKTVLDKLYHGMKEDSSVIRNRIYLERIKNETPNSIAELQL
FT                   MLQRSIADCIMSEPIGSEKYNIAKEIQINLEDTIRFMKRALE"
     MNEEIQTLLI YQICDSLRFQ ANMEDISVDD VMDVMQENIM VECLLDGVIM DKADVQKIVI        60
     QYVTDGELGE EAIGDKMESM YSNSRKKLLK EIDDLDNTIS TNRKKDKLLN LYRDTVLNRL       120
     QNKKTVLDKL YHGMKEDSSV IRNRIYLERI KNETPNSIAE LQLMLQRSIA DCIMSEPIGS       180
     EKYNIAKEIQ INLEDTIRFM KRALE                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page