(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE146

CAGLA1_12.PE146      Location/Qualifiers
FT   CDS             complement(385581..387701)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437835"
FT                   /gene_name="GLC3"
FT                   /locus_tag="CAGL0M03377g"
FT                   /product="1,4-alpha-glucan-branching enzyme "
FT                   /EC_number="2.4.1.18"
FT                   /function="1,4-alpha-glucan branching enzyme activity "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="CAG62470.1"
FT                   /db_xref="GO:0003844"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG021253"
FT                   /db_xref="HOGENOM:HBG302308"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00003B706F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV0"
FT                   /transl_table=1
FT                   /translation="MSLTKIPENVQGAVSIDPWLEPFADVLSERRYLADKWLYDIKHAT
FT                   PDGSEQSLVDFARNAYKTYGLHANQQTKEIVYREWAPNAQRAFLVGEFNNWNEESHEMK
FT                   HKDEFGVFSITLAPLENGDFAIPHDSKIKVMFVLPDGSKVYRIPAWITRATQPSKETAQ
FT                   KYGPTYEGRFWNPPNSYQFKHQRPKFNLANDSIKIYEAHIGISSPEPKVASYKEFTQNV
FT                   LPRIKHLGYDAIQLMAIMEHAYYASFGYQVTNFFAISSRYGTPEDLKELIDTAHSMGIL
FT                   VLLDVIHSHASKNSEDGLNMFDGSDHQYFHSLTSGRGEHPLWDSRLFNYGSFEVQRFLL
FT                   ANLAYYIDVYQFDGFRFDGVTSMLYLHHGVGAGGAFSGDYNEYLSRDRSGVDHEALAYL
FT                   MLANDLVHDLLPESAVTIAEDVSGYPTLCLPRTAGGGGFDYRLAMALPDMWIKLLKTKQ
FT                   DDDWDMGHIVHTLTNRRHGEKVVAYCESHDQALVGDKTLAFWLMDAAMYTDMTVLKEPT
FT                   LVIDRGIALHKMIRLITHSLGGEAYLNFEGNEFGHPEWLDFPRVGNNDSYHYARRQFNL
FT                   VDDDLLRYRHLNEFDAAMQNCESKHQWLNTPQAYVSLKHEVDKVIAFERNGHLFVFNFH
FT                   PTQSFTDYRIGVDVAGTYKIVLNTDRAEFGGHNRIDEAQEFFTTDLEWNNRRNFIQVYI
FT                   PSRTAIVLTRQM"
     MSLTKIPENV QGAVSIDPWL EPFADVLSER RYLADKWLYD IKHATPDGSE QSLVDFARNA        60
     YKTYGLHANQ QTKEIVYREW APNAQRAFLV GEFNNWNEES HEMKHKDEFG VFSITLAPLE       120
     NGDFAIPHDS KIKVMFVLPD GSKVYRIPAW ITRATQPSKE TAQKYGPTYE GRFWNPPNSY       180
     QFKHQRPKFN LANDSIKIYE AHIGISSPEP KVASYKEFTQ NVLPRIKHLG YDAIQLMAIM       240
     EHAYYASFGY QVTNFFAISS RYGTPEDLKE LIDTAHSMGI LVLLDVIHSH ASKNSEDGLN       300
     MFDGSDHQYF HSLTSGRGEH PLWDSRLFNY GSFEVQRFLL ANLAYYIDVY QFDGFRFDGV       360
     TSMLYLHHGV GAGGAFSGDY NEYLSRDRSG VDHEALAYLM LANDLVHDLL PESAVTIAED       420
     VSGYPTLCLP RTAGGGGFDY RLAMALPDMW IKLLKTKQDD DWDMGHIVHT LTNRRHGEKV       480
     VAYCESHDQA LVGDKTLAFW LMDAAMYTDM TVLKEPTLVI DRGIALHKMI RLITHSLGGE       540
     AYLNFEGNEF GHPEWLDFPR VGNNDSYHYA RRQFNLVDDD LLRYRHLNEF DAAMQNCESK       600
     HQWLNTPQAY VSLKHEVDKV IAFERNGHLF VFNFHPTQSF TDYRIGVDVA GTYKIVLNTD       660
     RAEFGGHNRI DEAQEFFTTD LEWNNRRNFI QVYIPSRTAI VLTRQM                      706
//

If you have problems or comments...

PBIL Back to PBIL home page