(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE149

CAGLA1_12.PE149      Location/Qualifiers
FT   CDS             complement(393154..393990)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224167" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501144"
FT                   /locus_tag="CAGL0M03465g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62473.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG191130"
FT                   /db_xref="HOGENOM:HBG736287"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniParc:UPI00003B7072"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU7"
FT                   /transl_table=1
FT                   /translation="MSDKDQGSAQLAGDHQEYQNKNYDSDVENMAGGDHEIGKIYTSGA
FT                   NNEYIYIGRQKFLKTDLYEAFGGTLNPGLAPPSSHKFANPAPLGLSAFALTTFVLSMFN
FT                   AKAQGIVVPNVVVGLAMFYGGLVQLIAGIWEIALENTFGATALCSYGGFWLSFGAIYIP
FT                   WFGILEAYKDKESDLGNALGFYLLGWTIFTYGLTLCTLKSTVAFFALFFLLALVLLLLS
FT                   IGEFSGKVGCKRAGGVVGVVVAFIAWYNAYAGVASRQNSYIVAHPFPLPTNEKTLY"
     MSDKDQGSAQ LAGDHQEYQN KNYDSDVENM AGGDHEIGKI YTSGANNEYI YIGRQKFLKT        60
     DLYEAFGGTL NPGLAPPSSH KFANPAPLGL SAFALTTFVL SMFNAKAQGI VVPNVVVGLA       120
     MFYGGLVQLI AGIWEIALEN TFGATALCSY GGFWLSFGAI YIPWFGILEA YKDKESDLGN       180
     ALGFYLLGWT IFTYGLTLCT LKSTVAFFAL FFLLALVLLL LSIGEFSGKV GCKRAGGVVG       240
     VVVAFIAWYN AYAGVASRQN SYIVAHPFPL PTNEKTLY                               278
//

If you have problems or comments...

PBIL Back to PBIL home page