(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE151

CAGLA1_12.PE151      Location/Qualifiers
FT   CDS             complement(398183..400981)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184434" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348985"
FT                   /locus_tag="CAGL0M03531g"
FT                   /product="Similar to uniprot|P32074 Saccharomyces
FT                   cerevisiae YNL287w SEC21"
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="CAG62475.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="HOGENOM:HBG022373"
FT                   /db_xref="HOGENOM:HBG631201"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR014863"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="UniParc:UPI00003B7074"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU5"
FT                   /transl_table=1
FT                   /translation="MSTSTYKKFEQAGSSDLPDKMTIYQDCMNTFNETPVNPKRCRLLI
FT                   SRLLRLLAQGETFPRNEATALFFSISKLFQYPNDSLRQLVYLAIKEFSGISEDVLMATS
FT                   SIMKDVQNGSDLVKPNAIRSLTNVLDESTAFSAERLLKSALVSKHPSISSAALCTSYHL
FT                   LPISEVTVKRFTNETQEAVVDLKQFPSSSMNGEYYPNSTYITQYHALGLLYQLKKNDKM
FT                   ALLKLVRQFSEGNVLKNQLAKVELVRIVSELIQKDPQLFTQFKPLLNNWLSNKFESVQL
FT                   ETAKMITSFAIHNPRLVSPELYAAAISALQSLLSVPRVSTRFATLRILNRISMISPEKI
FT                   AICNPELESLVNDSNRNISTYAITTLLKTGTAKNISSLIHTITRFIHDVSDDFKIIIVD
FT                   AVRTLSLNFPQEWKSIVTFLIDVLKNSEGGFKYKNSIVEALIDIVSFVPQSKELALENL
FT                   CDFIEDCEYNEILVRILHLLGKEGPSTTNPSLYVRHIYNRVVLENSIIRSAAVVALSKF
FT                   ALTKNDSTLCESIISLLKRIVHDKDDEVRDRASIALKFIEAAKEKNDKVANDLIQSSSA
FT                   YDLSSLESKLSAYLSSNTDSFQTPFDSQSIPKYAEDELKAMELKKKQEKIFENKGDKTR
FT                   DSSKTESTSNSAGENFNAEAEYDDGKDDLLAAKYAEEMAAIPEINAFGSIVNTTKAVPL
FT                   TEPEAEFVVTGIKHLFADHVVIQFNIRNTLTDVILDNVSVSCVPEESGDVTLEEQFTIP
FT                   IDRLLPSAESSCYVAFKKPEAIVTETFMNSINFTTREVNPDTNEPFEGDEGFEDEYEID
FT                   PITLSGGDYVKSSFVGNFTSAFDELPHEEIAVYNIQEDISIQEVVDKVIQNTSCLPLGS
FT                   TQYVGGDSNSHTLKLFGKSALTGSKIGMLVKFIKSSKGVALKVQGKAEDATLCADLVNS
FT                   VI"
     MSTSTYKKFE QAGSSDLPDK MTIYQDCMNT FNETPVNPKR CRLLISRLLR LLAQGETFPR        60
     NEATALFFSI SKLFQYPNDS LRQLVYLAIK EFSGISEDVL MATSSIMKDV QNGSDLVKPN       120
     AIRSLTNVLD ESTAFSAERL LKSALVSKHP SISSAALCTS YHLLPISEVT VKRFTNETQE       180
     AVVDLKQFPS SSMNGEYYPN STYITQYHAL GLLYQLKKND KMALLKLVRQ FSEGNVLKNQ       240
     LAKVELVRIV SELIQKDPQL FTQFKPLLNN WLSNKFESVQ LETAKMITSF AIHNPRLVSP       300
     ELYAAAISAL QSLLSVPRVS TRFATLRILN RISMISPEKI AICNPELESL VNDSNRNIST       360
     YAITTLLKTG TAKNISSLIH TITRFIHDVS DDFKIIIVDA VRTLSLNFPQ EWKSIVTFLI       420
     DVLKNSEGGF KYKNSIVEAL IDIVSFVPQS KELALENLCD FIEDCEYNEI LVRILHLLGK       480
     EGPSTTNPSL YVRHIYNRVV LENSIIRSAA VVALSKFALT KNDSTLCESI ISLLKRIVHD       540
     KDDEVRDRAS IALKFIEAAK EKNDKVANDL IQSSSAYDLS SLESKLSAYL SSNTDSFQTP       600
     FDSQSIPKYA EDELKAMELK KKQEKIFENK GDKTRDSSKT ESTSNSAGEN FNAEAEYDDG       660
     KDDLLAAKYA EEMAAIPEIN AFGSIVNTTK AVPLTEPEAE FVVTGIKHLF ADHVVIQFNI       720
     RNTLTDVILD NVSVSCVPEE SGDVTLEEQF TIPIDRLLPS AESSCYVAFK KPEAIVTETF       780
     MNSINFTTRE VNPDTNEPFE GDEGFEDEYE IDPITLSGGD YVKSSFVGNF TSAFDELPHE       840
     EIAVYNIQED ISIQEVVDKV IQNTSCLPLG STQYVGGDSN SHTLKLFGKS ALTGSKIGML       900
     VKFIKSSKGV ALKVQGKAED ATLCADLVNS VI                                     932
//

If you have problems or comments...

PBIL Back to PBIL home page