(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE154

CAGLA1_12.PE154      Location/Qualifiers
FT   CDS             404993..406768
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248364" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501145"
FT                   /locus_tag="CAGL0M03597g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62478.1"
FT                   /db_xref="HOGENOM:HBG191085"
FT                   /db_xref="HOGENOM:HBG397409"
FT                   /db_xref="UniParc:UPI00003B7077"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU2"
FT                   /transl_table=1
FT                   /translation="MLLWVLFLYLLASGSAFRFGGNDSWWNRRDLAAGGSEVAVDMQLL
FT                   DIVNKADGGSTSTSSDVGASSSAQSNADDTNGDGDDDDGDDDDDDDGEDEPQIINSNLI
FT                   YEWTPIISKMTPGKVDNYMFNINPESTGLGFAPSYEILIFLSGNICQQPTNSTDLQIRV
FT                   YYSFDEKMLSNISLGNFETFSNGYLEALQISPVNHTSNGTTLNSKNLYVSVRLWDLIND
FT                   KEVDKDDPNIKNLTSTEWDYRLSISENDLVFQWDTRSWIDVLDTDSTSALISTGNVTDD
FT                   GQIYSNYTIYDPTLYDLYLYTYDEYQKFLNVSELSLCAIKNGPHLVSSEGASATNPPLE
FT                   MLQETGLKIQKRIAESSSGIAEQFYITGLTPNTTYAAFLTKKIGKGQSLSNVGGVLFDA
FT                   EIFTTQTSDACSLIFGMSFCSDNAYSVPSSEFTNGNKSDLAIEYDNIASALYSNFSKAL
FT                   QLVPCDADLDARYSPIRTCDDCATSYRDWICAVSIPRCSTTESSSYIYRSKTDNRNSYV
FT                   NKFIKPTEDYYEVLPCIDMCYAIVRDCPSVFNFKCPDQESEPELLFQSYNIFKQSSPFI
FT                   TCNFIGNASYLKIHK"
     MLLWVLFLYL LASGSAFRFG GNDSWWNRRD LAAGGSEVAV DMQLLDIVNK ADGGSTSTSS        60
     DVGASSSAQS NADDTNGDGD DDDGDDDDDD DGEDEPQIIN SNLIYEWTPI ISKMTPGKVD       120
     NYMFNINPES TGLGFAPSYE ILIFLSGNIC QQPTNSTDLQ IRVYYSFDEK MLSNISLGNF       180
     ETFSNGYLEA LQISPVNHTS NGTTLNSKNL YVSVRLWDLI NDKEVDKDDP NIKNLTSTEW       240
     DYRLSISEND LVFQWDTRSW IDVLDTDSTS ALISTGNVTD DGQIYSNYTI YDPTLYDLYL       300
     YTYDEYQKFL NVSELSLCAI KNGPHLVSSE GASATNPPLE MLQETGLKIQ KRIAESSSGI       360
     AEQFYITGLT PNTTYAAFLT KKIGKGQSLS NVGGVLFDAE IFTTQTSDAC SLIFGMSFCS       420
     DNAYSVPSSE FTNGNKSDLA IEYDNIASAL YSNFSKALQL VPCDADLDAR YSPIRTCDDC       480
     ATSYRDWICA VSIPRCSTTE SSSYIYRSKT DNRNSYVNKF IKPTEDYYEV LPCIDMCYAI       540
     VRDCPSVFNF KCPDQESEPE LLFQSYNIFK QSSPFITCNF IGNASYLKIH K                591
//

If you have problems or comments...

PBIL Back to PBIL home page