(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE156

CAGLA1_12.PE156      Location/Qualifiers
FT   CDS             complement(408582..410747)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248756" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044613"
FT                   /locus_tag="CAGL0M03641g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62480.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG058940"
FT                   /db_xref="HOGENOM:HBG397500"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI00003B7079"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU0"
FT                   /transl_table=1
FT                   /translation="MSSENLIDDAGVVSETTQPQEVHGSTDAPARTQDSDDVPKSNRAV
FT                   LSTAGLRLTHASRSDLKKPVLGFPKKSPSLPNFHENVQSDNENNSDPTLSKLLDESKFV
FT                   HNSHRLNFSLLKDDQPIDESDDTSGIETKEVKIEVKSQLHVPKTHKRTATLGGVSMNED
FT                   DGNLSVIDMYGDEVESRVSKPQVPAEATQVDNDESQDEEVPPHAGSNTSENPGQHNTEK
FT                   ATTEAAMTQEMLREQQIKADRRQSTFHYDRYGFKKQTNYVSEAKYDSWWNEYSQYCIRR
FT                   KHKWKQLLEKSGLPVDNDSPTRFPSKSEKLKRYVRKGIPAEWRGNAWWYFARGQDLLNR
FT                   NKDRYDQLLERMEILLSSDKKKIQDLDIIERDLHRTFPDNLHFQHNSYHGDEPPLISSL
FT                   RRVLVAFSLYNPKIGYCQSMNFLAGMLLLFLDEERAFWMLVIITSRYLPGVHNVNLEGV
FT                   NIDQAVLMLCIKEYLPEIWPYINPELKTINKTSNSLGIKNGGSTGVKNEFLYKLPPITL
FT                   CTASWFMGCFVGVMPVETTLRVWDCMFYEESHFLFKISLAIFKLCENDLSKVRNNGSSL
FT                   LPNYMNGNHKSMSKDESDMEVFQIIQVFPKSLIDPNDIFDKIILKKRLSFNRLDQEEID
FT                   RCRKYVATQRQKYKKFHDNGKNATFSGVNEDVPPAGESGTRIASDTINEALSSEIYGFK
FT                   KGLTGVHWNNSIKEKVRQMRKKIDKDD"
     MSSENLIDDA GVVSETTQPQ EVHGSTDAPA RTQDSDDVPK SNRAVLSTAG LRLTHASRSD        60
     LKKPVLGFPK KSPSLPNFHE NVQSDNENNS DPTLSKLLDE SKFVHNSHRL NFSLLKDDQP       120
     IDESDDTSGI ETKEVKIEVK SQLHVPKTHK RTATLGGVSM NEDDGNLSVI DMYGDEVESR       180
     VSKPQVPAEA TQVDNDESQD EEVPPHAGSN TSENPGQHNT EKATTEAAMT QEMLREQQIK       240
     ADRRQSTFHY DRYGFKKQTN YVSEAKYDSW WNEYSQYCIR RKHKWKQLLE KSGLPVDNDS       300
     PTRFPSKSEK LKRYVRKGIP AEWRGNAWWY FARGQDLLNR NKDRYDQLLE RMEILLSSDK       360
     KKIQDLDIIE RDLHRTFPDN LHFQHNSYHG DEPPLISSLR RVLVAFSLYN PKIGYCQSMN       420
     FLAGMLLLFL DEERAFWMLV IITSRYLPGV HNVNLEGVNI DQAVLMLCIK EYLPEIWPYI       480
     NPELKTINKT SNSLGIKNGG STGVKNEFLY KLPPITLCTA SWFMGCFVGV MPVETTLRVW       540
     DCMFYEESHF LFKISLAIFK LCENDLSKVR NNGSSLLPNY MNGNHKSMSK DESDMEVFQI       600
     IQVFPKSLID PNDIFDKIIL KKRLSFNRLD QEEIDRCRKY VATQRQKYKK FHDNGKNATF       660
     SGVNEDVPPA GESGTRIASD TINEALSSEI YGFKKGLTGV HWNNSIKEKV RQMRKKIDKD       720
     D                                                                       721
//

If you have problems or comments...

PBIL Back to PBIL home page