(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE157

CAGLA1_12.PE157      Location/Qualifiers
FT   CDS             411533..413152
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437838"
FT                   /gene_name="RIM21"
FT                   /locus_tag="CAGL0M03663g"
FT                   /product="pH-response regulator protein palH/RIM21 "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="CAG62481.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124042"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniParc:UPI00003B707A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJT9"
FT                   /transl_table=1
FT                   /translation="MAVSIYDSLRTPGPKHYKYKICDGIDLGDGLVIDPLNLDSLVVYA
FT                   KNVKWSSFCDYGVPLYLAADTMDTPYEYPPIIMNDWRWFIFNDHYFGKYWGYGLYTILM
FT                   VYSTIFVITVALTVLSFLTVNKGPYKITSLLLKLSSVLASTSIIYFLTSALSTISRQQE
FT                   HYGVANGNVFGTLLNSNLVIATLNLLSMFFYKLCQVSIVARLFERKLEWRIVVFVGGIM
FT                   SIVSFIISAIVSYTDRVGIRNDNLVTLSPFGLLFDIALETCFAFIIVTNVWGTRKTWVS
FT                   HLQMWYLALLTIAIVLLSPAMFLADVGTGLLSAYAATVSPLLYTMSTFVAWEWLERIHI
FT                   LKKAAQVKSLLGQKIYEDEQEGYNFAYYSVNNESNLDTNSDSHISLYNDMFRNSEQFSN
FT                   VGSNLSSKESSSLPAQMNSTGISFPTAVNQVEFQKRKSFLDHLTNFTYSRPYKIYKKSK
FT                   SIIQLRKRNSETVKNERSNEELSIEKVRRRLGLTNERREYVYNTKDIVFASDDDTESEC
FT                   ESNNILNESIDSHFPENGAGSV"
     MAVSIYDSLR TPGPKHYKYK ICDGIDLGDG LVIDPLNLDS LVVYAKNVKW SSFCDYGVPL        60
     YLAADTMDTP YEYPPIIMND WRWFIFNDHY FGKYWGYGLY TILMVYSTIF VITVALTVLS       120
     FLTVNKGPYK ITSLLLKLSS VLASTSIIYF LTSALSTISR QQEHYGVANG NVFGTLLNSN       180
     LVIATLNLLS MFFYKLCQVS IVARLFERKL EWRIVVFVGG IMSIVSFIIS AIVSYTDRVG       240
     IRNDNLVTLS PFGLLFDIAL ETCFAFIIVT NVWGTRKTWV SHLQMWYLAL LTIAIVLLSP       300
     AMFLADVGTG LLSAYAATVS PLLYTMSTFV AWEWLERIHI LKKAAQVKSL LGQKIYEDEQ       360
     EGYNFAYYSV NNESNLDTNS DSHISLYNDM FRNSEQFSNV GSNLSSKESS SLPAQMNSTG       420
     ISFPTAVNQV EFQKRKSFLD HLTNFTYSRP YKIYKKSKSI IQLRKRNSET VKNERSNEEL       480
     SIEKVRRRLG LTNERREYVY NTKDIVFASD DDTESECESN NILNESIDSH FPENGAGSV        539
//

If you have problems or comments...

PBIL Back to PBIL home page