(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE160

CAGLA1_12.PE160      Location/Qualifiers
FT   CDS             complement(420316..422901)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437841"
FT                   /locus_tag="CAGL0M03729g"
FT                   /product="Similar to uniprot|P48562 Saccharomyces
FT                   cerevisiae YNL298w CLA4"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62484.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B707D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT6"
FT                   /transl_table=1
FT                   /translation="MSLSAAAAKISDSDFQSIGPAPRPPVSAGGAAFNKTQPITRYMSQ
FT                   LDLNSGRANRSNSNVRRKSGWVSYKDDGLLSFLWQKRFMVLNDSALTLYKNEKVTEDPV
FT                   LKIPLTVIVSVSKNQLKQYCFELTRVSERNSSNGGQSGNTDSMAKKTIYIATKTETDLI
FT                   SWLDSIFAKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMPTNWEKLLKHSRITGEDWN
FT                   NDSAAVIQVLNFYQEYNNGEGSTYGAGSTTSVSSGSTNSSQINLLKDTNTSTNSSDKVS
FT                   PISQANSMVPQRRAPSPPKQSSTVNSVNSVNVVPSQNSSQQAINMPNRSNTPIRQGSSP
FT                   YQNNISSKNNMAPRMQAPSPAGGNKIQNSLPKLATHNNYNQQQGFVNKYPSPGSSPGSS
FT                   QPPSPINGYRPHHNMSNPYANKGPGSPLNARPNQQTTIQNQVPFNQRNGSQQQSNYPMK
FT                   VYPTIPVLKQPQQGGGYPNQNVIQNQTSVNAANMAMRQQQQQQNKINQNNPPAALQPVR
FT                   QAPKKPAGVSKDGAEKAKKTSKPTMSNAEIMSKLKQVTLDADPSTLFKMIEKAGQGASG
FT                   SVYLAERTEIIEADGPQHQRGGTEHEDPLIGDKVAIKQMVLSKQPRKELIVNEIMVMND
FT                   SRHENIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVR
FT                   ETCKGLKFLHDKNIIHRDIKSDNVLLDTKARVKITDFGFCAKLTDQRSKRATMVGTPYW
FT                   MAPEVVKQKEYDAKVDVWSLGIMAIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPQS
FT                   LSLEIKRFLSVCLCVDVKYRASTEELLHHSFFNIACEPEDLTSLLENKK"
     MSLSAAAAKI SDSDFQSIGP APRPPVSAGG AAFNKTQPIT RYMSQLDLNS GRANRSNSNV        60
     RRKSGWVSYK DDGLLSFLWQ KRFMVLNDSA LTLYKNEKVT EDPVLKIPLT VIVSVSKNQL       120
     KQYCFELTRV SERNSSNGGQ SGNTDSMAKK TIYIATKTET DLISWLDSIF AKCPLLSGVS       180
     SPTNFTHKVH VGFDPETGSF VGMPTNWEKL LKHSRITGED WNNDSAAVIQ VLNFYQEYNN       240
     GEGSTYGAGS TTSVSSGSTN SSQINLLKDT NTSTNSSDKV SPISQANSMV PQRRAPSPPK       300
     QSSTVNSVNS VNVVPSQNSS QQAINMPNRS NTPIRQGSSP YQNNISSKNN MAPRMQAPSP       360
     AGGNKIQNSL PKLATHNNYN QQQGFVNKYP SPGSSPGSSQ PPSPINGYRP HHNMSNPYAN       420
     KGPGSPLNAR PNQQTTIQNQ VPFNQRNGSQ QQSNYPMKVY PTIPVLKQPQ QGGGYPNQNV       480
     IQNQTSVNAA NMAMRQQQQQ QNKINQNNPP AALQPVRQAP KKPAGVSKDG AEKAKKTSKP       540
     TMSNAEIMSK LKQVTLDADP STLFKMIEKA GQGASGSVYL AERTEIIEAD GPQHQRGGTE       600
     HEDPLIGDKV AIKQMVLSKQ PRKELIVNEI MVMNDSRHEN IVNFLEAYLK TEDDLWVVME       660
     YMEGGSLTDI IENSPTNGSA YSPLSEPQIA YIVRETCKGL KFLHDKNIIH RDIKSDNVLL       720
     DTKARVKITD FGFCAKLTDQ RSKRATMVGT PYWMAPEVVK QKEYDAKVDV WSLGIMAIEM       780
     LEGEPPYLNE DPLKALYLIA TNGTPKLKHP QSLSLEIKRF LSVCLCVDVK YRASTEELLH       840
     HSFFNIACEP EDLTSLLENK K                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page