(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE161

CAGLA1_12.PE161      Location/Qualifiers
FT   CDS             complement(423750..425630)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044614"
FT                   /locus_tag="CAGL0M03751g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleotidyltransferase activity"
FT                   /protein_id="CAG62485.1"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG124542"
FT                   /db_xref="HOGENOM:HBG395964"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniParc:UPI00003B707E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT5"
FT                   /transl_table=1
FT                   /translation="MRGDRSKRKVAKYQKKESARVKRLRRSSFNALQRNIEVFNDNKEF
FT                   LNKYENLELDLSDPENRTHLLSEYNDDLTQSDGESKADNHNDSYDTIPVIDIDSGDEGI
FT                   VSDIKISGGKLEDNDDFIAFSSSSEDENSGAENNESEDYLSSGNTSSDDELAGRRNAER
FT                   ELNADFPWLLNHDHSKQKEISDWLTAEIRDFVAYISPSREEIETRNKTIAKIRRSVKRL
FT                   WTDADLQVFGSYATDMYLPGSDIDCVVNSKSGDKENRQYLYELARHLKNDGLATRVEVI
FT                   AKSRVPIIKFVEPESDIHIDVSFERSNGLEAAKLIREWIGDTPGLRELTLVVKQFLHAR
FT                   RLNDVHTGGLGGFSIICLVFSFLRLHPRIITGDIDPLDNLGVLLIEFFELYGKNFAYDD
FT                   VAICVDDSRATYKPKTSCRFYPPARTSFTLAIQDPGDPTNNLSRGSFNVRDIKKSFSGA
FT                   FDLLVNKCFELDAATFKNRVGKSILGNVIKYRGAPRDFNDERALVENRAIIENEHYHRK
FT                   RARVVHADDEDTSDEDDMFINISANEEETEEMYKVEKVEKVVKKRKIAKADTNTKTKTK
FT                   TKAKARNHTSIDQLMGIPEDEEPPVIQEREKKSLSMQDKRDYWLSKGQAL"
     MRGDRSKRKV AKYQKKESAR VKRLRRSSFN ALQRNIEVFN DNKEFLNKYE NLELDLSDPE        60
     NRTHLLSEYN DDLTQSDGES KADNHNDSYD TIPVIDIDSG DEGIVSDIKI SGGKLEDNDD       120
     FIAFSSSSED ENSGAENNES EDYLSSGNTS SDDELAGRRN AERELNADFP WLLNHDHSKQ       180
     KEISDWLTAE IRDFVAYISP SREEIETRNK TIAKIRRSVK RLWTDADLQV FGSYATDMYL       240
     PGSDIDCVVN SKSGDKENRQ YLYELARHLK NDGLATRVEV IAKSRVPIIK FVEPESDIHI       300
     DVSFERSNGL EAAKLIREWI GDTPGLRELT LVVKQFLHAR RLNDVHTGGL GGFSIICLVF       360
     SFLRLHPRII TGDIDPLDNL GVLLIEFFEL YGKNFAYDDV AICVDDSRAT YKPKTSCRFY       420
     PPARTSFTLA IQDPGDPTNN LSRGSFNVRD IKKSFSGAFD LLVNKCFELD AATFKNRVGK       480
     SILGNVIKYR GAPRDFNDER ALVENRAIIE NEHYHRKRAR VVHADDEDTS DEDDMFINIS       540
     ANEEETEEMY KVEKVEKVVK KRKIAKADTN TKTKTKTKAK ARNHTSIDQL MGIPEDEEPP       600
     VIQEREKKSL SMQDKRDYWL SKGQAL                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page