(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE174

CAGLA1_12.PE174      Location/Qualifiers
FT   CDS             448125..449054
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_family="HOG000034183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437845"
FT                   /locus_tag="CAGL0M04037g"
FT                   /product="Similar to uniprot|P32453 Saccharomyces
FT                   cerevisiae YNL315c ATP11"
FT                   /biological_process="protein complex assembly"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62498.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006461"
FT                   /db_xref="HOGENOM:HBG058597"
FT                   /db_xref="HOGENOM:HBG397660"
FT                   /db_xref="InterPro:IPR010591"
FT                   /db_xref="PDB:2P4F"
FT                   /db_xref="UniParc:UPI00003B708B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS2"
FT                   /transl_table=1
FT                   /translation="MLTRSLVPALRRRITVVARQYSIEDRYKEKLLQKAKAEGVESIEE
FT                   LKKRLADQIEEKKKELNKIDPLRELEQHLNAGSRIHTNKEHKTTKMSNKSNEKSGNVLP
FT                   KDKPYKTLDDYLKLDKIKDLSKQEVEFLWRAKWSNRDDSLVAVVPYVKTFQGMYKYAVK
FT                   NPLFVLPLPRENAADGNKADKDSVPVELQYVQWQFAGPNTVHCLITSLAEYKLHQDFAK
FT                   PHTTIQFHLDLANDKDMVLMNGQVESDSNVSLQDAQLLLLNVQRFYGAMGSETSIAKER
FT                   IQLLEDFNKGSQNFDINKLIQLAQSMEN"
     MLTRSLVPAL RRRITVVARQ YSIEDRYKEK LLQKAKAEGV ESIEELKKRL ADQIEEKKKE        60
     LNKIDPLREL EQHLNAGSRI HTNKEHKTTK MSNKSNEKSG NVLPKDKPYK TLDDYLKLDK       120
     IKDLSKQEVE FLWRAKWSNR DDSLVAVVPY VKTFQGMYKY AVKNPLFVLP LPRENAADGN       180
     KADKDSVPVE LQYVQWQFAG PNTVHCLITS LAEYKLHQDF AKPHTTIQFH LDLANDKDMV       240
     LMNGQVESDS NVSLQDAQLL LLNVQRFYGA MGSETSIAKE RIQLLEDFNK GSQNFDINKL       300
     IQLAQSMEN                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page