(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE175

CAGLA1_12.PE175      Location/Qualifiers
FT   CDS             449398..450450
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000018970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437846"
FT                   /locus_tag="CAGL0M04059g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="prephenate dehydratase activity"
FT                   /biological_process="L-phenylalanine biosynthetic process "
FT                   /protein_id="CAG62499.1"
FT                   /db_xref="GO:0004664"
FT                   /db_xref="GO:0009094"
FT                   /db_xref="HOGENOM:HBG411300"
FT                   /db_xref="HOGENOM:HBG693866"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="UniParc:UPI00003B708C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS1"
FT                   /transl_table=1
FT                   /translation="MTVKVLFLGPEGTYSHQAAIQQFSHLVDYNVVYEAVDSIPSCVDK
FT                   LIEHDNDIEDVDLYSVVPLENSTNGQVVFTYDILRNLMQGSNGTNMRIRENQVVAPITI
FT                   VGEQYVSILHCLISPDPSIGIESLQNYDTLKIYSHPQVWGQVSKYLVELQKRFPNLKLE
FT                   RINCNSTSEAVLQAAEEQSSSQSSGILNLAIASEIAASIYQCYIIQHSINDILGNTTRF
FT                   LVFKKKSNHRRLLAPPSATPQRVSLLTFTIKQDDPGSLVEVLSVLKDFSLNMCSISSRP
FT                   YLLRSEQISQQGENFRRRNWQYIFFIEFYIEQDKEFDKDKFCDRIDALCGDWCHWGRFP
FT                   RDICYYKNTA"
     MTVKVLFLGP EGTYSHQAAI QQFSHLVDYN VVYEAVDSIP SCVDKLIEHD NDIEDVDLYS        60
     VVPLENSTNG QVVFTYDILR NLMQGSNGTN MRIRENQVVA PITIVGEQYV SILHCLISPD       120
     PSIGIESLQN YDTLKIYSHP QVWGQVSKYL VELQKRFPNL KLERINCNST SEAVLQAAEE       180
     QSSSQSSGIL NLAIASEIAA SIYQCYIIQH SINDILGNTT RFLVFKKKSN HRRLLAPPSA       240
     TPQRVSLLTF TIKQDDPGSL VEVLSVLKDF SLNMCSISSR PYLLRSEQIS QQGENFRRRN       300
     WQYIFFIEFY IEQDKEFDKD KFCDRIDALC GDWCHWGRFP RDICYYKNTA                  350
//

If you have problems or comments...

PBIL Back to PBIL home page