(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE176

CAGLA1_12.PE176      Location/Qualifiers
FT   CDS             complement(450572..451939)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044616"
FT                   /gene_name="PFS2"
FT                   /locus_tag="CAGL0M04081g"
FT                   /product="Polyadenylation factor subunit 2 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mitosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62500.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG268234"
FT                   /db_xref="HOGENOM:HBG736644"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B708D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJS0"
FT                   /transl_table=1
FT                   /translation="MDQSAAVEGVPQKKYLTLRRSVDVSSSYNRLYYLKKHGLSLPPIE
FT                   PETSFTANIMPPDAYKRNDRIVNLPTKFTHLSSNKVKHVIPAIQWSPEGRRLIVATFSG
FT                   EFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPNFNMVKELDR
FT                   IHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHPELGL
FT                   IVSGSKDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLR
FT                   ASMNELMCVRDEVDFMELEWSTINESMFTVGCYDGSLKHFDLGQDTEKPIHIIPFAHEK
FT                   CISAIAYNPVGHILATAAKDRTIRFWTRARPVDPNAFDDPTYNNKKMTGWFFGINNDIN
FT                   AVREKSEYGAAPPPASTAFPQQTQYNNNISRVPEIKEPTPTTDKEQRTSILPGLSI"
     MDQSAAVEGV PQKKYLTLRR SVDVSSSYNR LYYLKKHGLS LPPIEPETSF TANIMPPDAY        60
     KRNDRIVNLP TKFTHLSSNK VKHVIPAIQW SPEGRRLIVA TFSGEFSLWN GSSFTFETIM       120
     QAHDTSVTTM KYSHAGDWMI SGDADGTIKI WQPNFNMVKE LDRIHTEGIR DVAFSNNDSK       180
     FVTCSDDNIL KIWNFSNGQQ ERVLSGHHWD VRSCDWHPEL GLIVSGSKDN LVKLWDPRSG       240
     QCVSTLLKFK HTVLKTRFQP TKGNLLAAIS KDKSCRVFDL RASMNELMCV RDEVDFMELE       300
     WSTINESMFT VGCYDGSLKH FDLGQDTEKP IHIIPFAHEK CISAIAYNPV GHILATAAKD       360
     RTIRFWTRAR PVDPNAFDDP TYNNKKMTGW FFGINNDINA VREKSEYGAA PPPASTAFPQ       420
     QTQYNNNISR VPEIKEPTPT TDKEQRTSIL PGLSI                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page