(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE177

CAGLA1_12.PE177      Location/Qualifiers
FT   CDS             452677..454272
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348987"
FT                   /locus_tag="CAGL0M04103g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62501.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B708E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR9"
FT                   /transl_table=1
FT                   /translation="MEQVTIGVISLDSSPTENYTLNTAETRQSFQLSGKSEVNTIPGEK
FT                   YEELKMKYIRQHTKAVVLCCLISFGGMILGWDIGTVGGVSIMPSFNNAFGDQTTIVSSA
FT                   KELSNMKRGLYISIFNIGCALGGIMFSRLSNTVGRRVGILTAIAKYTLVLTVQLFSNGN
FT                   FILLLASRFVLGVTVGAISVLVPMFVSESAPIKIRGALVVVYQLAITLGILFGNILNYM
FT                   TNKHLSMVDPMNNMAWKIPMLFGYLWAAIVAVGACITPESVHFLAKIRNDYESAKISYS
FT                   IMNNISVFDHETIDYVNNLLVKQDVYNENDLRNHKFEFLYGKPKYGKRLLIGIMVMAFQ
FT                   QLSGINYFFYYGTSLFKSVGIKDTYATAIILSSVNFISTFAGIYLVESLGRRSTLIYGS
FT                   FGMFICMIFYASFGTLSLRKDLLSFVLIIVTCLFISIFAITIGPVSFVVVAELFPTRTR
FT                   SVSMSICSSFNWLVNFAIALATPVIINRIGFLYGFFFAGCLLLATGFEAFFVPETKNKT
FT                   EEEIDYMFQNNLKS"
     MEQVTIGVIS LDSSPTENYT LNTAETRQSF QLSGKSEVNT IPGEKYEELK MKYIRQHTKA        60
     VVLCCLISFG GMILGWDIGT VGGVSIMPSF NNAFGDQTTI VSSAKELSNM KRGLYISIFN       120
     IGCALGGIMF SRLSNTVGRR VGILTAIAKY TLVLTVQLFS NGNFILLLAS RFVLGVTVGA       180
     ISVLVPMFVS ESAPIKIRGA LVVVYQLAIT LGILFGNILN YMTNKHLSMV DPMNNMAWKI       240
     PMLFGYLWAA IVAVGACITP ESVHFLAKIR NDYESAKISY SIMNNISVFD HETIDYVNNL       300
     LVKQDVYNEN DLRNHKFEFL YGKPKYGKRL LIGIMVMAFQ QLSGINYFFY YGTSLFKSVG       360
     IKDTYATAII LSSVNFISTF AGIYLVESLG RRSTLIYGSF GMFICMIFYA SFGTLSLRKD       420
     LLSFVLIIVT CLFISIFAIT IGPVSFVVVA ELFPTRTRSV SMSICSSFNW LVNFAIALAT       480
     PVIINRIGFL YGFFFAGCLL LATGFEAFFV PETKNKTEEE IDYMFQNNLK S                531
//

If you have problems or comments...

PBIL Back to PBIL home page