(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE181

CAGLA1_12.PE181      Location/Qualifiers
FT   CDS             complement(461446..463251)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195773"
FT                   /locus_tag="CAGL0M04191g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG62505.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B7092"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR5"
FT                   /transl_table=1
FT                   /translation="MKFSSLCMLASVAAHSKAAKNVADLSYVKLDFDKYYGETFETAKR
FT                   GRSQADIRVNKRANGYEEVQITNQNSFYSVTLEVGTPPQSVVVLVDTGSSDLWITGSDN
FT                   PYCRGSTGTSGKNMLLEAELKRALEDARDIAKERTTLAPRDDEHNDGLLSWLTGSDGLL
FT                   GGQGGTTITLTDSAQPTAAGTSNGARATINCAKYGTFDTSKSSTWHSNDTAFMIQYGDS
FT                   TFASGTWGMDNLHLSDLNVTGLSFAVANRTNSTVGVLGIGLPALEVTYSGRTAVSGQRP
FT                   YQYDNFPLVLLRNGAIKSNSYSLFLNNASAETGSVLFGAVDHSKYLGDLYTIPMVNTYA
FT                   SQGYKNPIQFEVTLNGLGISSSSDNTTITTTKIPALLDSGTTLTYLPQALVTRIVQKLQ
FT                   ATYSNRAGYYVFSCPSQSDDTEVVFDFGGFHINAPITNFIIGSSGDSCILGIMPQSGGG
FT                   IILGDSFLNSAYVVYDLENYEISMAQANYAGGQEDIEVISSSVPGAVRAPGFSSTWSTL
FT                   ATSFNTQGDIFTVQAAATVSGSATNTGTGRATATGNSNSTRSTTSRSRTSATSTRSDSQ
FT                   KKNDASRTSFTSTLLFVAGLLVSFI"
     MKFSSLCMLA SVAAHSKAAK NVADLSYVKL DFDKYYGETF ETAKRGRSQA DIRVNKRANG        60
     YEEVQITNQN SFYSVTLEVG TPPQSVVVLV DTGSSDLWIT GSDNPYCRGS TGTSGKNMLL       120
     EAELKRALED ARDIAKERTT LAPRDDEHND GLLSWLTGSD GLLGGQGGTT ITLTDSAQPT       180
     AAGTSNGARA TINCAKYGTF DTSKSSTWHS NDTAFMIQYG DSTFASGTWG MDNLHLSDLN       240
     VTGLSFAVAN RTNSTVGVLG IGLPALEVTY SGRTAVSGQR PYQYDNFPLV LLRNGAIKSN       300
     SYSLFLNNAS AETGSVLFGA VDHSKYLGDL YTIPMVNTYA SQGYKNPIQF EVTLNGLGIS       360
     SSSDNTTITT TKIPALLDSG TTLTYLPQAL VTRIVQKLQA TYSNRAGYYV FSCPSQSDDT       420
     EVVFDFGGFH INAPITNFII GSSGDSCILG IMPQSGGGII LGDSFLNSAY VVYDLENYEI       480
     SMAQANYAGG QEDIEVISSS VPGAVRAPGF SSTWSTLATS FNTQGDIFTV QAAATVSGSA       540
     TNTGTGRATA TGNSNSTRST TSRSRTSATS TRSDSQKKND ASRTSFTSTL LFVAGLLVSF       600
     I                                                                       601
//

If you have problems or comments...

PBIL Back to PBIL home page