(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE182

CAGLA1_12.PE182      Location/Qualifiers
FT   CDS             complement(463756..464523)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001121" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195774"
FT                   /locus_tag="CAGL0M04213g"
FT                   /product="Similar to uniprot|Q12288 Saccharomyces
FT                   cerevisiae YLR126c"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG62506.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG097859"
FT                   /db_xref="HOGENOM:HBG202458"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI00003B7093"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR4"
FT                   /transl_table=1
FT                   /translation="MTVAARKVAIFYTDHPNEWSRDDGTFATMAVELLEQAKEHEPYVG
FT                   AEGGIEYRVFDVYNGELPSVDELSSGDYLGLYITGSRYDSFDTETQWIVDLRKLLYRLV
FT                   NETTLPIVGICFGHQVLARSLGAQVGRNPKGLEAGVHGVQLNATGKTLFSRDRLYLSEL
FT                   HSDHVEEVPPGYENWGHTEKSHCQGLYKPQRVLTFQGHPEFTTQLAIKSTQHKHQTGQL
FT                   SDEEYAETIQRCHSNNDGVHAARNIWKLYHGKI"
     MTVAARKVAI FYTDHPNEWS RDDGTFATMA VELLEQAKEH EPYVGAEGGI EYRVFDVYNG        60
     ELPSVDELSS GDYLGLYITG SRYDSFDTET QWIVDLRKLL YRLVNETTLP IVGICFGHQV       120
     LARSLGAQVG RNPKGLEAGV HGVQLNATGK TLFSRDRLYL SELHSDHVEE VPPGYENWGH       180
     TEKSHCQGLY KPQRVLTFQG HPEFTTQLAI KSTQHKHQTG QLSDEEYAET IQRCHSNNDG       240
     VHAARNIWKL YHGKI                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page