(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE183

CAGLA1_12.PE183      Location/Qualifiers
FT   CDS             complement(464973..467324)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000001122" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437847"
FT                   /locus_tag="CAGL0M04235g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ubiquitin protein ligase binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cullin-RING ubiquitin ligase complex "
FT                   /protein_id="CAG62507.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0031461"
FT                   /db_xref="GO:0031625"
FT                   /db_xref="HOGENOM:HBG124050"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014786"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="UniParc:UPI00003B7094"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR3"
FT                   /transl_table=1
FT                   /translation="MILTGDTKTFKRAVLEYGVNGNKNSNAEEWNVLLQWLDPAGKKNH
FT                   QLKPPNLLVKTMIEKLLLGSNDYQLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIER
FT                   HVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEI
FT                   VDYFDYCQTDSTSIVLDIILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSL
FT                   LFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFN
FT                   CVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQR
FT                   KDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLTALTNELKDTEICSYTEESDDVVDPMI
FT                   GSFSKEEDSMVLEQVIKRYMEWIPEVPTSFGKGILSDHKLDLFDILLELLESKETLVIE
FT                   FKNLLTKKLLDLRGYTLDKKWSKFLSLLKKRFDNRSTETMDEEDLNNINTIDIMLRDIY
FT                   KSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQSKAGDFEMDGELEHLLELYSRF
FT                   YSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEG
FT                   LTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWKGDSTYAAIPDVLE
FT                   ESVVERSSQHEDKQENHVERALPYIKDILLNLGTLKIDKLHALLQSAMPKDSHYSTVNQ
FT                   KQLQDYLDTLVEEGVLSSASNDSYKLPQIR"
     MILTGDTKTF KRAVLEYGVN GNKNSNAEEW NVLLQWLDPA GKKNHQLKPP NLLVKTMIEK        60
     LLLGSNDYQL LSNIQDYYCW QCRVYFYNEY KRIETLNELK RIERHVLFPL KYIPIFEGNN       120
     RVENEVRLFG NYLLKTNKKV MSRAVERLRN RMLEDDFELA TEIVDYFDYC QTDSTSIVLD       180
     IILDKIEQFC QLHYTRKWNK RYLIMETFNQ FISQYWDQLS SLLFCQEDNH TITNTLYKYF       240
     EKQFISIRTN EIFDICISNP ASVQPTLLEL RKEISTVNDF NCVVVELLSK FNLKVINPSI       300
     VTADALFLYI RTIKTFSILD PSGRYLQTIS SYVKPHFRQR KDLVHLLLFS MLGLDETDQL       360
     NTMPSQVSEE KLTALTNELK DTEICSYTEE SDDVVDPMIG SFSKEEDSMV LEQVIKRYME       420
     WIPEVPTSFG KGILSDHKLD LFDILLELLE SKETLVIEFK NLLTKKLLDL RGYTLDKKWS       480
     KFLSLLKKRF DNRSTETMDE EDLNNINTID IMLRDIYKSR QIATDMQLDL HNTNVKVYPK       540
     IVSALYWSNN SDTQSKAGDF EMDGELEHLL ELYSRFYSQK QIGQKLELRR DNGSVSLNLS       600
     FLDGRTVHCK ASLRQYSVLT LFKSPKHDSN FPTEGLTISE LCARSGMQSK QMADILRYWV       660
     SKDVLYFSDG KYRTLEFLRW KGDSTYAAIP DVLEESVVER SSQHEDKQEN HVERALPYIK       720
     DILLNLGTLK IDKLHALLQS AMPKDSHYST VNQKQLQDYL DTLVEEGVLS SASNDSYKLP       780
     QIR                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page