(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE184

CAGLA1_12.PE184      Location/Qualifiers
FT   CDS             467785..468606
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112177" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437848"
FT                   /gene_name="DCN1"
FT                   /locus_tag="CAGL0M04257g"
FT                   /product="Defective in cullin neddylation protein 1 "
FT                   /protein_id="CAG62508.1"
FT                   /db_xref="HOGENOM:HBG202460"
FT                   /db_xref="HOGENOM:HBG206132"
FT                   /db_xref="InterPro:IPR005176"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014764"
FT                   /db_xref="UniParc:UPI00003B7095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJR2"
FT                   /transl_table=1
FT                   /translation="MVSRHEKELMKTFQSLTSCTDEGKAKRYLSANNWNINYALNEYYD
FT                   KEVGGFTEDHMIRHQFKYPDELVSLFGHYAALIEEDGTQSITPDGLIDYIQDLGYNLED
FT                   LVTISLAHFLQCKNLENPITEKQFLYFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTT
FT                   IYNYSFDLNASKQGVVETDIAIEYWKLFFEENRTKLSGIIKVDQAHLDLWCKFLQDEHK
FT                   KLIHKDTWQMLLLFFKKFPSLDAIKTEYNEADAWPYTIDEFYEYLEERNVL"
     MVSRHEKELM KTFQSLTSCT DEGKAKRYLS ANNWNINYAL NEYYDKEVGG FTEDHMIRHQ        60
     FKYPDELVSL FGHYAALIEE DGTQSITPDG LIDYIQDLGY NLEDLVTISL AHFLQCKNLE       120
     NPITEKQFLY FWYNEGCYTL EQMRHYLEDC ERKLCNDWKY FTTIYNYSFD LNASKQGVVE       180
     TDIAIEYWKL FFEENRTKLS GIIKVDQAHL DLWCKFLQDE HKKLIHKDTW QMLLLFFKKF       240
     PSLDAIKTEY NEADAWPYTI DEFYEYLEER NVL                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page