(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE187

CAGLA1_12.PE187      Location/Qualifiers
FT   CDS             complement(474158..476269)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001123" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501153"
FT                   /locus_tag="CAGL0M04323g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62511.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124051"
FT                   /db_xref="HOGENOM:HBG202461"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B7098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ9"
FT                   /transl_table=1
FT                   /translation="MNTFQADWGEIPQMPKDQVFTPQDQLTNYNDNMMDNLLDFNYNDV
FT                   DALLSEELKDLDIPLAPSPRDLNMNAEQSLNWMQDIQGHRSNKPSMSHKRGMSGTAIFG
FT                   FKNHNKTLSIASFSKNTDIINEAENENVKGNTDNQNGFVLSQVLLKQQEELRLALEKQK
FT                   EVNRNLERQLRENRLQQEHIQRVLHDQEAVTSQLTAQNVTESPSKQRSPTKYQGDDAII
FT                   VTKNSSSGGYVFPPPPRVTLNNEAVTPPLSFSRFSNIDQMESSDPLNYLQPNADFTEAY
FT                   ASHKTPESSFGKEHASVLSTSEFLRPTNAARESSSKAMYSSPNSMISPHRKKDSVLSTV
FT                   STILQPQDDYQNTASPPSQMLNLEEANLENEQKNNGKMLRAPVEIMPTIPGSKNNTPMT
FT                   ANKSGFMPQKHTFQHTPVKAKNNVDMNERSLVRPELSGTPLNKSVQNGMHFREEDDSNI
FT                   LHHISEIPQGSTSHNNTTAGDDSNVSNRLQFSNTESSPSRQRKKPTTLPPGYIDRYVKE
FT                   LPDKNFECLFPNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKT
FT                   HDKHFSCPCGKKFSSEQSMMKHKNRHNCTGPARVPDSKMVSKSPRKQSSPTKLSSAIMN
FT                   SPIKENYLKENTNLHIDQLRMDPKMRNALEDGGLLKPVERTEAMAFPSPLSGYSDLGSP
FT                   FRDLGTIEE"
     MNTFQADWGE IPQMPKDQVF TPQDQLTNYN DNMMDNLLDF NYNDVDALLS EELKDLDIPL        60
     APSPRDLNMN AEQSLNWMQD IQGHRSNKPS MSHKRGMSGT AIFGFKNHNK TLSIASFSKN       120
     TDIINEAENE NVKGNTDNQN GFVLSQVLLK QQEELRLALE KQKEVNRNLE RQLRENRLQQ       180
     EHIQRVLHDQ EAVTSQLTAQ NVTESPSKQR SPTKYQGDDA IIVTKNSSSG GYVFPPPPRV       240
     TLNNEAVTPP LSFSRFSNID QMESSDPLNY LQPNADFTEA YASHKTPESS FGKEHASVLS       300
     TSEFLRPTNA ARESSSKAMY SSPNSMISPH RKKDSVLSTV STILQPQDDY QNTASPPSQM       360
     LNLEEANLEN EQKNNGKMLR APVEIMPTIP GSKNNTPMTA NKSGFMPQKH TFQHTPVKAK       420
     NNVDMNERSL VRPELSGTPL NKSVQNGMHF REEDDSNILH HISEIPQGST SHNNTTAGDD       480
     SNVSNRLQFS NTESSPSRQR KKPTTLPPGY IDRYVKELPD KNFECLFPNC GKFFRRRYNI       540
     KSHIQTHLED KPYKCDFEGC TKAFVRNHDL ARHKKTHDKH FSCPCGKKFS SEQSMMKHKN       600
     RHNCTGPARV PDSKMVSKSP RKQSSPTKLS SAIMNSPIKE NYLKENTNLH IDQLRMDPKM       660
     RNALEDGGLL KPVERTEAMA FPSPLSGYSD LGSPFRDLGT IEE                         703
//

If you have problems or comments...

PBIL Back to PBIL home page