(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE189

CAGLA1_12.PE189      Location/Qualifiers
FT   CDS             479260..481074
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246747" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501154"
FT                   /locus_tag="CAGL0M04367g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62513.1"
FT                   /db_xref="HOGENOM:HBG059778"
FT                   /db_xref="HOGENOM:HBG396752"
FT                   /db_xref="InterPro:IPR002573"
FT                   /db_xref="InterPro:IPR007521"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00003B709A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ7"
FT                   /transl_table=1
FT                   /translation="MPLSEIEPHSPSAKKASGHRRSRRHSSIGSSSRKPSLTRNRSTLR
FT                   LMRTISIESLNNDTFSASGGEDEDNSNSDYNDVSGTNQDLEDKIGNLSIKSGISQSSSD
FT                   IKTTPAKKGSGGVSASSTDNSIEVPFVKVALDITLPQDYFKKDVANMIQSLKVPRWYAR
FT                   GLVESPLKMESLRLTKIAGAMTNAIFKVEYPALPSLLLRVYGSNNDMIIDREYELQVLA
FT                   RLSVQHIGPSLYGCFLNGRFEQFLENATTLTKDDIRDWKTSQRIARRMKELHTGVPLLR
FT                   FEKEQGSMAWNKIDQWLKEIEMNGGDWISNDDNVQQVFGAPNWKEFKESIRKYREWLFE
FT                   NSKSPYVFCHNDAQYGNLLFSAPVINSEKNDLKKSLDESNLSTSSLFPSDSRVSLKEII
FT                   NPTKQEQSQDSKLVVIDFEYAGANVAAYDLSNHFSEWMYDYNSSTPHKCFSDQYPTTEQ
FT                   MLNFVYSYVSHLRGGVKTDIDDDARLLYNDIKKWRGTVQLFWSLWALIQSGKIQFQEQE
FT                   STKVDEGLVGEKYIIKTEDTAIDELVDDIDTNDVIEAPEGVSIDTFDYLGYCTDKISVF
FT                   WGDIIGFNIITKSECIENKVKYLSTDLL"
     MPLSEIEPHS PSAKKASGHR RSRRHSSIGS SSRKPSLTRN RSTLRLMRTI SIESLNNDTF        60
     SASGGEDEDN SNSDYNDVSG TNQDLEDKIG NLSIKSGISQ SSSDIKTTPA KKGSGGVSAS       120
     STDNSIEVPF VKVALDITLP QDYFKKDVAN MIQSLKVPRW YARGLVESPL KMESLRLTKI       180
     AGAMTNAIFK VEYPALPSLL LRVYGSNNDM IIDREYELQV LARLSVQHIG PSLYGCFLNG       240
     RFEQFLENAT TLTKDDIRDW KTSQRIARRM KELHTGVPLL RFEKEQGSMA WNKIDQWLKE       300
     IEMNGGDWIS NDDNVQQVFG APNWKEFKES IRKYREWLFE NSKSPYVFCH NDAQYGNLLF       360
     SAPVINSEKN DLKKSLDESN LSTSSLFPSD SRVSLKEIIN PTKQEQSQDS KLVVIDFEYA       420
     GANVAAYDLS NHFSEWMYDY NSSTPHKCFS DQYPTTEQML NFVYSYVSHL RGGVKTDIDD       480
     DARLLYNDIK KWRGTVQLFW SLWALIQSGK IQFQEQESTK VDEGLVGEKY IIKTEDTAID       540
     ELVDDIDTND VIEAPEGVSI DTFDYLGYCT DKISVFWGDI IGFNIITKSE CIENKVKYLS       600
     TDLL                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page