(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE190

CAGLA1_12.PE190      Location/Qualifiers
FT   CDS             481522..483702
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437850"
FT                   /gene_name="SLX4"
FT                   /locus_tag="CAGL0M04389g"
FT                   /product="Structure-specific endonuclease subunit SLX4 "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62514.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG124053"
FT                   /db_xref="InterPro:IPR018574"
FT                   /db_xref="UniParc:UPI00003B709B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJQ6"
FT                   /transl_table=1
FT                   /translation="MDFERAQKNFDAFVINGETDETPNDELRHESQHSDFDTCGTQVPE
FT                   MNFSDDDNSDCGNNEIDRLAHNATETTDKEGDDSIIVTQERIAENRNNSVIEIEDEDQI
FT                   DLSVVNSKEEDNIFLNTQIQSRLDDHEKDLQQKAVLKSFNFEYVDKDESPNMMGSRYIR
FT                   KKSPKKRNSRKNTEEAIQASKSISKRQNNANSLLQILSGKKSKVNAIIKNQRFKYESKT
FT                   GVLKRASQVSNSTSTTYGKEEWKQIKNVLRTRYSKLENSDDRELENFINYLSEQLEKEP
FT                   NLWTSSQIAISTNENNESYRQDSIGSLLTLSQVMGDKSAILESDDEYPDVRPNGESFFK
FT                   CADDSQQLKDDLNIVSQTNSNTNVSGVESVHGLEGKNLYSMGEKEEVTNKMTDFVSKEV
FT                   EQSQVPLLSIHRRGRNNGSYFIFDSSDEYKTIIEIDSSIRQPMDNSNEPSITNHRRTPV
FT                   FSKSQSILDQECDSIEDISLSQGSFKAVTTLISPVKDGSTAQNSQAMDIPTQFSGIPRL
FT                   LDLKTVPKLPFESFNENSKDYRIIISKKKLLELKQAIKRLANIELTEEHEVLGNIDGQP
FT                   GEELFAVVLSISNNLELLSSPGVDTHTKEKSPSLAELRKDLDKIGLKPVRLKSQIIENL
FT                   ASASQVVTVDESNQKKVGVTSKSEVFEFLTHLVKQEPDLLTRIYCFQPITMNDLINKLR
FT                   NKDSFVDLIDDGTIREWTDKLGICIRSNNLKD"
     MDFERAQKNF DAFVINGETD ETPNDELRHE SQHSDFDTCG TQVPEMNFSD DDNSDCGNNE        60
     IDRLAHNATE TTDKEGDDSI IVTQERIAEN RNNSVIEIED EDQIDLSVVN SKEEDNIFLN       120
     TQIQSRLDDH EKDLQQKAVL KSFNFEYVDK DESPNMMGSR YIRKKSPKKR NSRKNTEEAI       180
     QASKSISKRQ NNANSLLQIL SGKKSKVNAI IKNQRFKYES KTGVLKRASQ VSNSTSTTYG       240
     KEEWKQIKNV LRTRYSKLEN SDDRELENFI NYLSEQLEKE PNLWTSSQIA ISTNENNESY       300
     RQDSIGSLLT LSQVMGDKSA ILESDDEYPD VRPNGESFFK CADDSQQLKD DLNIVSQTNS       360
     NTNVSGVESV HGLEGKNLYS MGEKEEVTNK MTDFVSKEVE QSQVPLLSIH RRGRNNGSYF       420
     IFDSSDEYKT IIEIDSSIRQ PMDNSNEPSI TNHRRTPVFS KSQSILDQEC DSIEDISLSQ       480
     GSFKAVTTLI SPVKDGSTAQ NSQAMDIPTQ FSGIPRLLDL KTVPKLPFES FNENSKDYRI       540
     IISKKKLLEL KQAIKRLANI ELTEEHEVLG NIDGQPGEEL FAVVLSISNN LELLSSPGVD       600
     THTKEKSPSL AELRKDLDKI GLKPVRLKSQ IIENLASASQ VVTVDESNQK KVGVTSKSEV       660
     FEFLTHLVKQ EPDLLTRIYC FQPITMNDLI NKLRNKDSFV DLIDDGTIRE WTDKLGICIR       720
     SNNLKD                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page