(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE193

CAGLA1_12.PE193      Location/Qualifiers
FT   CDS             complement(489048..491183)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501155"
FT                   /locus_tag="CAGL0M04455g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62517.1"
FT                   /db_xref="HOGENOM:HBG124054"
FT                   /db_xref="UniParc:UPI00003B709E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ3"
FT                   /transl_table=1
FT                   /translation="MLRALPLLRKRILPAFRTRIRLYSDDSLKEKLLSTRGKKKMPEKQ
FT                   KIVVLNPGQVTSFKRRRRGPVTDHANTHTTTDSLITRHNRPISAPRTKLSILEGVDLGI
FT                   STNGSKEEDKEKLTDTVLEEIDQKRRKLMVFRSTVSEEQAVKAIGYQKPVKPIMSQKRY
FT                   EQLENLLKSAYTVNQLRAYSKKMFGPSLFKKSKAFIIKKIMNEYWQCQVDENINEKDDL
FT                   IIERELDIKTRDTYLLLLTDNGKILHNLARIGAILAVAPEENKIIIRASANVIRYVEIS
FT                   LNRILENVKTEIVPIEKLIRDHSIDGKLDGDMNVEQIIDLVQKQASVYIDLISDSSEEK
FT                   QYNISAFGKKRIDTAKLYLTWASKYTPHVQEEYITTGDKCMKEKCKEYPYTDMDSFNWL
FT                   DKNKLWYRLQLPENKLLGKTDKLEYPPTIEMLDVKRIYDFLTDKNISLKQKLLPVKGTR
FT                   QHVISVTMGQLLKAGNSMIRTFLPRIPTISNFLMDLPYFEETHEGDLSVLGENDDYYVQ
FT                   LKFKPDLSSIPPGIKSYPPNMELWFELDDRDNAIKASMDCIFSVSEKAVMLEAPQHPFD
FT                   FKIVSDAVVSLNPSLENDDPGQWLEGQDELKHYVDQAKLDFGQGNKMLLGNSVCVNIPT
FT                   EEEGTVQVRYDFVNTYRHRITRLKFRDRFLVQYSNINGGARGGQTNRIDLICDDNPDYN
FT                   DFSNFIQQSLEFGKKKI"
     MLRALPLLRK RILPAFRTRI RLYSDDSLKE KLLSTRGKKK MPEKQKIVVL NPGQVTSFKR        60
     RRRGPVTDHA NTHTTTDSLI TRHNRPISAP RTKLSILEGV DLGISTNGSK EEDKEKLTDT       120
     VLEEIDQKRR KLMVFRSTVS EEQAVKAIGY QKPVKPIMSQ KRYEQLENLL KSAYTVNQLR       180
     AYSKKMFGPS LFKKSKAFII KKIMNEYWQC QVDENINEKD DLIIERELDI KTRDTYLLLL       240
     TDNGKILHNL ARIGAILAVA PEENKIIIRA SANVIRYVEI SLNRILENVK TEIVPIEKLI       300
     RDHSIDGKLD GDMNVEQIID LVQKQASVYI DLISDSSEEK QYNISAFGKK RIDTAKLYLT       360
     WASKYTPHVQ EEYITTGDKC MKEKCKEYPY TDMDSFNWLD KNKLWYRLQL PENKLLGKTD       420
     KLEYPPTIEM LDVKRIYDFL TDKNISLKQK LLPVKGTRQH VISVTMGQLL KAGNSMIRTF       480
     LPRIPTISNF LMDLPYFEET HEGDLSVLGE NDDYYVQLKF KPDLSSIPPG IKSYPPNMEL       540
     WFELDDRDNA IKASMDCIFS VSEKAVMLEA PQHPFDFKIV SDAVVSLNPS LENDDPGQWL       600
     EGQDELKHYV DQAKLDFGQG NKMLLGNSVC VNIPTEEEGT VQVRYDFVNT YRHRITRLKF       660
     RDRFLVQYSN INGGARGGQT NRIDLICDDN PDYNDFSNFI QQSLEFGKKK I                711
//

If you have problems or comments...

PBIL Back to PBIL home page