(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE2

CAGLA1_12.PE2        Location/Qualifiers
FT   CDS             22039..23691
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435638"
FT                   /locus_tag="CAGL0M00154g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62327.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B6FE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK93"
FT                   /transl_table=1
FT                   /translation="MSSSISDREAVKVDSGKQEIYEVSSSLDIDELRSDFDPEQNIRED
FT                   LTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGE
FT                   MSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHH
FT                   FPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHE
FT                   YIGFKNWTHGEAPFVNGFKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTV
FT                   FWRILIFYVLSTFFIGMNIPYDYPGLSTKSVMTSPFTLVFQMAGTRGAGSFMNAVILTS
FT                   VISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFI
FT                   GAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQGKTDLLQFKNWTYPFGPYFLV
FT                   IFTVFIILIQGWQAFDPWSVTDFFSVYLELFVFPFVYIIWWLWKRDWFVKYEDMDFVTD
FT                   RYIPTKEIVELNERLDNLKGWKKVRQIFSDYIA"
     MSSSISDREA VKVDSGKQEI YEVSSSLDID ELRSDFDPEQ NIREDLTRAL SPRHINMISI        60
     AGIIGTGLYL STAKSLHNGG PASLFMNYTI IGGVVYLTML CLGEMSTFMP ISGSFCSYAR       120
     KFGSESFACA LMWNYWFNDA VSVASDLTAL QLVLDYWHTA DHHFPYWGAS LIFWFFVLFL       180
     NVIHVRIYGE AEYWLAMLKV IAIVIFFIMS IIVNVGKNPQ HEYIGFKNWT HGEAPFVNGF       240
     KGFASLFVSA CFAYGGTESI TLTGGEASNP VRNTPKIVKT VFWRILIFYV LSTFFIGMNI       300
     PYDYPGLSTK SVMTSPFTLV FQMAGTRGAG SFMNAVILTS VISACNHALF AGSRIMYNMA       360
     LDGYLPKKIV GRTNRYKAPY VAVLITWAVG GLCLGASFIG AGTLWTWLQN IVGVSNQIAW       420
     LCIGITSIRF RKGLEVQGKT DLLQFKNWTY PFGPYFLVIF TVFIILIQGW QAFDPWSVTD       480
     FFSVYLELFV FPFVYIIWWL WKRDWFVKYE DMDFVTDRYI PTKEIVELNE RLDNLKGWKK       540
     VRQIFSDYIA                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page