(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE20

CAGLA1_12.PE20       Location/Qualifiers
FT   CDS             66078..67787
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000193384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436684"
FT                   /locus_tag="CAGL0M00550g"
FT                   /product="Similar to uniprot|P47164 Saccharomyces
FT                   cerevisiae YJR130c STR2"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG62345.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG262693"
FT                   /db_xref="HOGENOM:HBG634482"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B6FF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK75"
FT                   /transl_table=1
FT                   /translation="MISEILGESIPKNTEHAVSVCLPLWADVVGYEEGDARVLDSLTTG
FT                   YPRFFIHASVKRLCNLISEQYARAGESCLCFPSYLVAKRCREYITVKSKQLDKDADIGK
FT                   IRILQLAMPQDDTDHTGIFDCKIAALFFKSELFPLAKQYWQHSGEIVSSRLADYVTERL
FT                   YPNAIHIDEATKDNKTFIETRFGRNLDSSFINRAKDILRNRIAHKVVETDHNQDVATNV
FT                   FLFPSGMASIFTAHRLLLNYDHIRVSNIKHNGVDKSDDIIGYGEPYLKTVMFGFPYTDT
FT                   LSILKKFNHTYFLGLGDESAMKDLIGILESGEQILAVFLEAPSNPLLKMCDMSKLKQLS
FT                   QQYGFFIVVDETVSGFVNIDILSYCDIVCSSLTKIFSGDSNVIAGSLVVNPASKLHDFA
FT                   IDFLNDPKRNEDLLWCEDSVYLERNSRDFIDRAQKINKIAEDLVSTVLLEEEGQLLEKI
FT                   YYPSLTSPESKLNYDSVKCNNGGYGGLISIVFKREDQAKVFYDNLSLNKGPSLGTNFTL
FT                   VCPYAILAHYAELDEVAKYGVVKNLVRISVGLESLETLQTIFRKAFDAAKDV"
     MISEILGESI PKNTEHAVSV CLPLWADVVG YEEGDARVLD SLTTGYPRFF IHASVKRLCN        60
     LISEQYARAG ESCLCFPSYL VAKRCREYIT VKSKQLDKDA DIGKIRILQL AMPQDDTDHT       120
     GIFDCKIAAL FFKSELFPLA KQYWQHSGEI VSSRLADYVT ERLYPNAIHI DEATKDNKTF       180
     IETRFGRNLD SSFINRAKDI LRNRIAHKVV ETDHNQDVAT NVFLFPSGMA SIFTAHRLLL       240
     NYDHIRVSNI KHNGVDKSDD IIGYGEPYLK TVMFGFPYTD TLSILKKFNH TYFLGLGDES       300
     AMKDLIGILE SGEQILAVFL EAPSNPLLKM CDMSKLKQLS QQYGFFIVVD ETVSGFVNID       360
     ILSYCDIVCS SLTKIFSGDS NVIAGSLVVN PASKLHDFAI DFLNDPKRNE DLLWCEDSVY       420
     LERNSRDFID RAQKINKIAE DLVSTVLLEE EGQLLEKIYY PSLTSPESKL NYDSVKCNNG       480
     GYGGLISIVF KREDQAKVFY DNLSLNKGPS LGTNFTLVCP YAILAHYAEL DEVAKYGVVK       540
     NLVRISVGLE SLETLQTIFR KAFDAAKDV                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page