(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE200

CAGLA1_12.PE200      Location/Qualifiers
FT   CDS             complement(503641..504537)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000256147" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437856"
FT                   /locus_tag="CAGL0M04609g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="spermidine synthase activity"
FT                   /biological_process="spermidine biosynthetic process "
FT                   /protein_id="CAG62524.1"
FT                   /db_xref="GO:0004766"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG011091"
FT                   /db_xref="HOGENOM:HBG635113"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="UniParc:UPI00003B70A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP6"
FT                   /transl_table=1
FT                   /translation="MAEQKYIKDGWFYEMSDEHFPGQALALKVKQVLYQSKSEFQDILV
FT                   FESTNHGVCLVLDGIIQCSERDEFAYQEMIAHIPLYCHANPKKVLVIGGGDGGVVREVV
FT                   KHDKVESVTMVEIDKTVIELAKKYLPGMSCAMDHPKLKLNLCDGFKFLKEASMLSNDDK
FT                   YDVIITDSSDPDGPAEAFFQKEYFELLQNALKPDGIVIAQASENVWLDINYLASLRKTA
FT                   NEVFTNTMISYTTVPTYTSGQLGLIVCTNSNDYDLTTPQRQPSVSEQNQLRYYNSQIHS
FT                   ASFVLPNWADMLIYDKK"
     MAEQKYIKDG WFYEMSDEHF PGQALALKVK QVLYQSKSEF QDILVFESTN HGVCLVLDGI        60
     IQCSERDEFA YQEMIAHIPL YCHANPKKVL VIGGGDGGVV REVVKHDKVE SVTMVEIDKT       120
     VIELAKKYLP GMSCAMDHPK LKLNLCDGFK FLKEASMLSN DDKYDVIITD SSDPDGPAEA       180
     FFQKEYFELL QNALKPDGIV IAQASENVWL DINYLASLRK TANEVFTNTM ISYTTVPTYT       240
     SGQLGLIVCT NSNDYDLTTP QRQPSVSEQN QLRYYNSQIH SASFVLPNWA DMLIYDKK         298
//

If you have problems or comments...

PBIL Back to PBIL home page