(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE202

CAGLA1_12.PE202      Location/Qualifiers
FT   CDS             505982..508861
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437858"
FT                   /locus_tag="CAGL0M04653g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG62526.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059805"
FT                   /db_xref="HOGENOM:HBG202471"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR007810"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019453"
FT                   /db_xref="UniParc:UPI00003B70A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP4"
FT                   /transl_table=1
FT                   /translation="MEVEIEHVELGFINELNKNICGLQVEGNLMCFALRTGSLFLIDLD
FT                   TPSNVIRCQIPLVRDGGVNAEKVLKIWLNPSRSLILVKTNFAKYYLCDVDVIVKTNGES
FT                   MTQNAIASVKQLSKKNCDVRSVAWVRNAKATGMHDKFNLLIGTARGQVYYIEINSKLSE
FT                   QNATLLYESPDSIDGIYWNDANGDIIIASKNKLIYWDGLQSSSNNNKNDREISPKITLS
FT                   KKRKSNEVEEYEHMHMEYTNKFAVYKNSFAWVTESGIVFSNVEQVKKSNKKVLGSSKVI
FT                   LNVELPNSKKPIRDIILSDYHILILRESSITIVNQLDNSVIYNQSIWSNDNEHILGFAS
FT                   DVHYKQATFWCFSASNIFEIILKKESNSVWRLLCDQQRYDDALNLQDLSLFEQSSIQYL
FT                   KGMHLLEENVYSDAAKCFGKSDTVSIPEIALKLLDGDDGMLKIGEQKLNALQFFLSEKL
FT                   LNYRHKDSLKYTIILDWIMWNYVRLFCLIDEKACSEREPDRLKYWDQRKEEISASVKKL
FT                   IDDNINLLERGTFYQLLEKSGRRIELLYLAEKLNDHQYLMNYWIRNENWYESLKVLQKA
FT                   KDPQLAYKHANILLVNCSQSTINTWMTMENLNPVFLIDAILTYFSIYQKSTKGSKVLQE
FT                   NYALTYLKWYVGNNDVNDKIIYNTIVYMMITTPIIQEGNDAMQTDHNNDNDVIEFMENY
FT                   SSKSHLEFVLRLSLKFERIKVAIYLLKLSDQYEDAVDLALSNGLVDEAKEIANMESLAK
FT                   DFTIKRKHWIKIAQVVLSQHLEKPDIKQNIRSIIRESEGTVKINDLLPFFNEFTTVANL
FT                   KDELVRSLEEHNHEIITIRDKIKHSLELKKDIIHETEKFKERYRILEPGKSCDQCQKML
FT                   QTRKFLVFPCGHCFHTDCLIRAILSSNDYNLKGKIENFQKRLNKDRKSVNPKELEELMA
FT                   TKCCLCSDIAINKIDEATIDDKERSQWVI"
     MEVEIEHVEL GFINELNKNI CGLQVEGNLM CFALRTGSLF LIDLDTPSNV IRCQIPLVRD        60
     GGVNAEKVLK IWLNPSRSLI LVKTNFAKYY LCDVDVIVKT NGESMTQNAI ASVKQLSKKN       120
     CDVRSVAWVR NAKATGMHDK FNLLIGTARG QVYYIEINSK LSEQNATLLY ESPDSIDGIY       180
     WNDANGDIII ASKNKLIYWD GLQSSSNNNK NDREISPKIT LSKKRKSNEV EEYEHMHMEY       240
     TNKFAVYKNS FAWVTESGIV FSNVEQVKKS NKKVLGSSKV ILNVELPNSK KPIRDIILSD       300
     YHILILRESS ITIVNQLDNS VIYNQSIWSN DNEHILGFAS DVHYKQATFW CFSASNIFEI       360
     ILKKESNSVW RLLCDQQRYD DALNLQDLSL FEQSSIQYLK GMHLLEENVY SDAAKCFGKS       420
     DTVSIPEIAL KLLDGDDGML KIGEQKLNAL QFFLSEKLLN YRHKDSLKYT IILDWIMWNY       480
     VRLFCLIDEK ACSEREPDRL KYWDQRKEEI SASVKKLIDD NINLLERGTF YQLLEKSGRR       540
     IELLYLAEKL NDHQYLMNYW IRNENWYESL KVLQKAKDPQ LAYKHANILL VNCSQSTINT       600
     WMTMENLNPV FLIDAILTYF SIYQKSTKGS KVLQENYALT YLKWYVGNND VNDKIIYNTI       660
     VYMMITTPII QEGNDAMQTD HNNDNDVIEF MENYSSKSHL EFVLRLSLKF ERIKVAIYLL       720
     KLSDQYEDAV DLALSNGLVD EAKEIANMES LAKDFTIKRK HWIKIAQVVL SQHLEKPDIK       780
     QNIRSIIRES EGTVKINDLL PFFNEFTTVA NLKDELVRSL EEHNHEIITI RDKIKHSLEL       840
     KKDIIHETEK FKERYRILEP GKSCDQCQKM LQTRKFLVFP CGHCFHTDCL IRAILSSNDY       900
     NLKGKIENFQ KRLNKDRKSV NPKELEELMA TKCCLCSDIA INKIDEATID DKERSQWVI        959
//

If you have problems or comments...

PBIL Back to PBIL home page