(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE205

CAGLA1_12.PE205      Location/Qualifiers
FT   CDS             complement(510921..511862)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094487" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195776"
FT                   /gene_name="RRP36"
FT                   /locus_tag="CAGL0M04719g"
FT                   /product="rRNA biogenesis protein RRP36 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAG62529.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG351277"
FT                   /db_xref="HOGENOM:HBG398117"
FT                   /db_xref="InterPro:IPR009292"
FT                   /db_xref="UniParc:UPI00003B70AA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJP1"
FT                   /transl_table=1
FT                   /translation="MSYYFKNIKPSYDDDSDEVSDEQDLDAILASKMRGRAESDDESSE
FT                   EEDDGLSKLSFGSLKKAEDQLEEEERGELRKKRKPQHSKPINDEPEVRHKVYKEEEQEE
FT                   SDSESGSDDGAFFEEDERDNHSRPKNKNSKKRKHAPTEHSSKKRVSKIRDIPGLEIARQ
FT                   AKSGIYQDVRFTKATGEATDFSVIRRRYKFLDEYREKEIEEMERLLNDKKFVNKAESRE
FT                   IENMKEKVRSMKSRLQSVKNRELEQQIVKDYEGKLNEGNKNRFHLKKAEKRKVIQKWKF
FT                   DHMKAKQREKVMERKRKKKLGKEFKQFEFHNR"
     MSYYFKNIKP SYDDDSDEVS DEQDLDAILA SKMRGRAESD DESSEEEDDG LSKLSFGSLK        60
     KAEDQLEEEE RGELRKKRKP QHSKPINDEP EVRHKVYKEE EQEESDSESG SDDGAFFEED       120
     ERDNHSRPKN KNSKKRKHAP TEHSSKKRVS KIRDIPGLEI ARQAKSGIYQ DVRFTKATGE       180
     ATDFSVIRRR YKFLDEYREK EIEEMERLLN DKKFVNKAES REIENMKEKV RSMKSRLQSV       240
     KNRELEQQIV KDYEGKLNEG NKNRFHLKKA EKRKVIQKWK FDHMKAKQRE KVMERKRKKK       300
     LGKEFKQFEF HNR                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page