(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE206

CAGLA1_12.PE206      Location/Qualifiers
FT   CDS             complement(512229..513143)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248396" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437860"
FT                   /locus_tag="CAGL0M04741g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG62530.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG059632"
FT                   /db_xref="HOGENOM:HBG397428"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI00003B70AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP0"
FT                   /transl_table=1
FT                   /translation="MKVYLLTLLVYIASVFAQDQSFYKDDPNIIELTPSNFDRVVHNTN
FT                   YTTLVEFYAPWCGYCKQLKNTIHSLGKASDSIFQVAAVNCDKASNKQLCGEYGVEGFPT
FT                   LKVFKPGKAGKTAVKKHASETYMGERKLAPLINFIKAKIKNHVKKLTSADMVSKLVNSQ
FT                   SSNKYAVVLFSKQSSIPVTYKSIAIDWLDRVKFYCYLNTKKTLVESLKSFESESAEIIG
FT                   PLVDRIGKLSAGKDKSLLVLIDKENQKISVLEDKITKSNVAKFIIDNTSLKPKEGPYSK
FT                   RDDYLAKLKLNKKKKTQVQNDEL"
     MKVYLLTLLV YIASVFAQDQ SFYKDDPNII ELTPSNFDRV VHNTNYTTLV EFYAPWCGYC        60
     KQLKNTIHSL GKASDSIFQV AAVNCDKASN KQLCGEYGVE GFPTLKVFKP GKAGKTAVKK       120
     HASETYMGER KLAPLINFIK AKIKNHVKKL TSADMVSKLV NSQSSNKYAV VLFSKQSSIP       180
     VTYKSIAIDW LDRVKFYCYL NTKKTLVESL KSFESESAEI IGPLVDRIGK LSAGKDKSLL       240
     VLIDKENQKI SVLEDKITKS NVAKFIIDNT SLKPKEGPYS KRDDYLAKLK LNKKKKTQVQ       300
     NDEL                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page