(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE211

CAGLA1_12.PE211      Location/Qualifiers
FT   CDS             532872..533189
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216624" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437864"
FT                   /locus_tag="CAGL0M04873g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62535.1"
FT                   /db_xref="HOGENOM:HBG059636"
FT                   /db_xref="HOGENOM:HBG499888"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00003B70B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN5"
FT                   /transl_table=1
FT                   /translation="MLMPKEERTKIHRHLFQEGVVVAKKDFNQPKHDEIDTKNLYVIKA
FT                   LQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQNAQQAQRPNRR
FT                   Y"
     MLMPKEERTK IHRHLFQEGV VVAKKDFNQP KHDEIDTKNL YVIKALQSLT SKGYVKTQFS        60
     WQYYYYTLTE EGVEYLREYL NLPEHIVPGT YIQNAQQAQR PNRRY                       105
//

If you have problems or comments...

PBIL Back to PBIL home page