(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE213

CAGLA1_12.PE213      Location/Qualifiers
FT   CDS             537760..539520
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195777"
FT                   /locus_tag="CAGL0M04917g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62537.1"
FT                   /db_xref="GO:0005089"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0035023"
FT                   /db_xref="HOGENOM:HBG124059"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="UniParc:UPI00003B70B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN3"
FT                   /transl_table=1
FT                   /translation="MYEQFQMISKNSLTPIRDYNNDFFHANDSKLPNLTRVKDGYGGAR
FT                   ASYSDSIGGDLDTMDNKIDDRVKKSSNSSVLTDMKNINLREMLKKFIFSEEKYIEMTEK
FT                   ALTSYRFNMQNKKMRSKKIFDPNSKEDVILFGNLETICAVSYLYLNSLSKIVTKLELNP
FT                   SSIDVIYDELVELHVTLFNRMKQPYTSYIIAYQNQTHLVKILENSTSKIVASWYHRSYD
FT                   DARQIKLSEILQCPYKHVHDWLENIKILKEWLVVGTSVEEFQKLIETFTDYISHLNIDN
FT                   EDNVRSSQHRHPISSIQISKSSDLNPESSGPSDDGNFVAYIPSVASSVYTEVIKPRMSP
FT                   KISLDEKPCNADSNHALMLLVRLFKEKLYHLTQLRKLLVKHDITNLADNFIMQIHSWTS
FT                   LLSIEKDSVFQNIHEQLNNKINLCVKLYKEKKEELGAFKFLKLESFIIKKLETVLALMK
FT                   TVKGYINDLKVLHKDYLIFKKEKQMKLQDIKRTLLGTHYEQIQNKLVEQLPRFLTYINQ
FT                   FMVLFLLSFNAYLRDALDILISVQADLLHTEEGVNEIEKDYDKRRNVMKKTVNSHYEKS
FT                   NNNIVLRRLF"
     MYEQFQMISK NSLTPIRDYN NDFFHANDSK LPNLTRVKDG YGGARASYSD SIGGDLDTMD        60
     NKIDDRVKKS SNSSVLTDMK NINLREMLKK FIFSEEKYIE MTEKALTSYR FNMQNKKMRS       120
     KKIFDPNSKE DVILFGNLET ICAVSYLYLN SLSKIVTKLE LNPSSIDVIY DELVELHVTL       180
     FNRMKQPYTS YIIAYQNQTH LVKILENSTS KIVASWYHRS YDDARQIKLS EILQCPYKHV       240
     HDWLENIKIL KEWLVVGTSV EEFQKLIETF TDYISHLNID NEDNVRSSQH RHPISSIQIS       300
     KSSDLNPESS GPSDDGNFVA YIPSVASSVY TEVIKPRMSP KISLDEKPCN ADSNHALMLL       360
     VRLFKEKLYH LTQLRKLLVK HDITNLADNF IMQIHSWTSL LSIEKDSVFQ NIHEQLNNKI       420
     NLCVKLYKEK KEELGAFKFL KLESFIIKKL ETVLALMKTV KGYINDLKVL HKDYLIFKKE       480
     KQMKLQDIKR TLLGTHYEQI QNKLVEQLPR FLTYINQFMV LFLLSFNAYL RDALDILISV       540
     QADLLHTEEG VNEIEKDYDK RRNVMKKTVN SHYEKSNNNI VLRRLF                      586
//

If you have problems or comments...

PBIL Back to PBIL home page