(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE214

CAGLA1_12.PE214      Location/Qualifiers
FT   CDS             539988..540689
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348992"
FT                   /locus_tag="CAGL0M04939g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62538.1"
FT                   /db_xref="HOGENOM:HBG058151"
FT                   /db_xref="HOGENOM:HBG203497"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="UniParc:UPI00003B70B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN2"
FT                   /transl_table=1
FT                   /translation="MDQNIDLNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLEN
FT                   KKKEVNELIVARFQILQADPHILVSNEEFQNLKMIRGNYDALLSSKSMEKKHKLTESSK
FT                   KTRIQVKKKKSKKSSKDGEKKVANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQV
FT                   WDYIKEHNLQSPEDRREIICDDRMRPIFGDKMTMFALNKILSKHLTKIEPKSEEADNSR
FT                   LSVKLEDGTQA"
     MDQNIDLNNY VSMLDAIISV SDPDKVSPKK IRKALEQLFS VSLENKKKEV NELIVARFQI        60
     LQADPHILVS NEEFQNLKMI RGNYDALLSS KSMEKKHKLT ESSKKTRIQV KKKKSKKSSK       120
     DGEKKVANPN SNAINSMKLR LSDDLYKFLG ERELPRTQVV KQVWDYIKEH NLQSPEDRRE       180
     IICDDRMRPI FGDKMTMFAL NKILSKHLTK IEPKSEEADN SRLSVKLEDG TQA              233
//

If you have problems or comments...

PBIL Back to PBIL home page