(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE215

CAGLA1_12.PE215      Location/Qualifiers
FT   CDS             complement(540950..542158)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195778"
FT                   /locus_tag="CAGL0M04961g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62539.1"
FT                   /db_xref="HOGENOM:HBG330467"
FT                   /db_xref="HOGENOM:HBG350158"
FT                   /db_xref="UniParc:UPI00003B70B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN1"
FT                   /transl_table=1
FT                   /translation="MATLHFTPKYEDDEVFSIAGKALKLTTKEDIQPHLDDLAKLKKCK
FT                   KLDFSGNTIGTEASKALADFLGSTESVRDVVEEINFADMYTSRLVDEVVDSLKALLPVL
FT                   LKCNKLTILNLSDNAFGLRTIDYLENYIANAVHLKHLILSNNGMGPFAGERIGKALFYL
FT                   AQNKTKAKESMLETFICGRNRLENGSALYLALGLKSHGDGLKVVKLYQNGIRPKGVATL
FT                   IHYGLKYNTKLEIIDLQDNTFTTAASLVLAKNLPLWKNTLVELNLNDCLLKAKGSKEVF
FT                   KVFEDNTFENLETLRFEYNEMEQDTLETVFLPAIEDNKFPKLKNLEINGNRFEEDSDPV
FT                   NALMDHFEDLELDDLEEPDSEEEEEEEEEEEKMEEIETSKIENELIELQIDNLAQELSK
FT                   ASI"
     MATLHFTPKY EDDEVFSIAG KALKLTTKED IQPHLDDLAK LKKCKKLDFS GNTIGTEASK        60
     ALADFLGSTE SVRDVVEEIN FADMYTSRLV DEVVDSLKAL LPVLLKCNKL TILNLSDNAF       120
     GLRTIDYLEN YIANAVHLKH LILSNNGMGP FAGERIGKAL FYLAQNKTKA KESMLETFIC       180
     GRNRLENGSA LYLALGLKSH GDGLKVVKLY QNGIRPKGVA TLIHYGLKYN TKLEIIDLQD       240
     NTFTTAASLV LAKNLPLWKN TLVELNLNDC LLKAKGSKEV FKVFEDNTFE NLETLRFEYN       300
     EMEQDTLETV FLPAIEDNKF PKLKNLEING NRFEEDSDPV NALMDHFEDL ELDDLEEPDS       360
     EEEEEEEEEE EKMEEIETSK IENELIELQI DNLAQELSKA SI                          402
//

If you have problems or comments...

PBIL Back to PBIL home page