(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE218

CAGLA1_12.PE218      Location/Qualifiers
FT   CDS             544448..546676
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501157"
FT                   /locus_tag="CAGL0M05027g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG62542.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059617"
FT                   /db_xref="HOGENOM:HBG735608"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="UniParc:UPI00003B70B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM8"
FT                   /transl_table=1
FT                   /translation="MITQASIPEVREDVIGFALGERKAILPQCQDLGPPDLITMVKYVP
FT                   TPNSNATAGTTSGNGAGGANNGTAGAANGNNSLSTADPAALLAEIHSHDKLKGAIGTFF
FT                   YTLGIDTSDPTSISISLKQIADAIAEKPQKWFGKFKNFSIARISLSTYNIFRRCDVNVI
FT                   VHIPGAVQTYVLDSNGEHLPVSGNQTTPTVASTASANPIDQASEMDVIWAETFISGVIR
FT                   SIMFMKDNADDGEAQPLVETLILNPLTAGKLDDVANTFIKLFPTVYERGVLTEAPCHVL
FT                   VPTRTNNYLVDTLVELVRLTKSVDICRPMLEELIKSYPDASIVLARVLMACDYEIDAID
FT                   IINRELLPHGEEDDTISPIFRAELLCLQTQFLMNVKNDYKLALEVALSAVKFSPSEFIP
FT                   WFLLTKIYIKLNDIENALLALNSCPMAQSHERYVLKRAVPIGSEDNLHLPLPENIGVDE
FT                   ILQLNPSDVNKEQLNSDPSLTRSAALNLKSTYLLAYRLLTEIVQITGWETLLKCRSKIF
FT                   VMEDEYQISTDEVSLTNQSNRNEDTPSELNMRTKRLCDRWLDNLFMLLYEDLKIYTLWQ
FT                   TEQLYFEAQNSKYKKLTYEWEAFGLCAQRLGHLPEAASAFQRGLSQRFAPMSARMLLNY
FT                   YIQEHHRVRNQSLSPNSELTSSQIISRINDLDSRIIDLCVKLCCWNHRWYIEFSIQLID
FT                   ALSVAVQDMGIMKVINEIASRYPDAVVSIMKENFLDFLENYTNGFFDA"
     MITQASIPEV REDVIGFALG ERKAILPQCQ DLGPPDLITM VKYVPTPNSN ATAGTTSGNG        60
     AGGANNGTAG AANGNNSLST ADPAALLAEI HSHDKLKGAI GTFFYTLGID TSDPTSISIS       120
     LKQIADAIAE KPQKWFGKFK NFSIARISLS TYNIFRRCDV NVIVHIPGAV QTYVLDSNGE       180
     HLPVSGNQTT PTVASTASAN PIDQASEMDV IWAETFISGV IRSIMFMKDN ADDGEAQPLV       240
     ETLILNPLTA GKLDDVANTF IKLFPTVYER GVLTEAPCHV LVPTRTNNYL VDTLVELVRL       300
     TKSVDICRPM LEELIKSYPD ASIVLARVLM ACDYEIDAID IINRELLPHG EEDDTISPIF       360
     RAELLCLQTQ FLMNVKNDYK LALEVALSAV KFSPSEFIPW FLLTKIYIKL NDIENALLAL       420
     NSCPMAQSHE RYVLKRAVPI GSEDNLHLPL PENIGVDEIL QLNPSDVNKE QLNSDPSLTR       480
     SAALNLKSTY LLAYRLLTEI VQITGWETLL KCRSKIFVME DEYQISTDEV SLTNQSNRNE       540
     DTPSELNMRT KRLCDRWLDN LFMLLYEDLK IYTLWQTEQL YFEAQNSKYK KLTYEWEAFG       600
     LCAQRLGHLP EAASAFQRGL SQRFAPMSAR MLLNYYIQEH HRVRNQSLSP NSELTSSQII       660
     SRINDLDSRI IDLCVKLCCW NHRWYIEFSI QLIDALSVAV QDMGIMKVIN EIASRYPDAV       720
     VSIMKENFLD FLENYTNGFF DA                                                742
//

If you have problems or comments...

PBIL Back to PBIL home page