(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE219

CAGLA1_12.PE219      Location/Qualifiers
FT   CDS             547489..548850
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437867"
FT                   /locus_tag="CAGL0M05049g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="CAG62543.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="HOGENOM:HBG051292"
FT                   /db_xref="HOGENOM:HBG324877"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI00003B70B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM7"
FT                   /transl_table=1
FT                   /translation="MKLLFSLQLWVLIGTLFPDAGAINLQDNKDSICAATALIQGGMLD
FT                   YYEGTRYGGTVGMFQPPYYWWQAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPNYD
FT                   YIPANQTTVEGNDDQGVWGLTILDAVERNFSAPIDGKPGWLAMSQGIFNTMYARWDMQS
FT                   CNGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAERVFDWLVGVGY
FT                   IVLSEKGNVYDGAKVEDNCTDITAIEWTYNHGVVLGGLAYMYNATNGSSVWQSRLTSVL
FT                   GGATAYFFQDDIMYESACQPYKTCNNDQRCFKSIFSRMLGFTSVLAPFTSDTIDPLLKA
FT                   SAMAAAGSCDGGTDGHTCGLDWQLKTNDGYYGLGEQMSALEVIQQLLIHERPAPYRADN
FT                   GGTSVGDAAAGLNSTTTNVLKNNLKITGGDRAGAAIVTTIVLGIIIGGAAWMMF"
     MKLLFSLQLW VLIGTLFPDA GAINLQDNKD SICAATALIQ GGMLDYYEGT RYGGTVGMFQ        60
     PPYYWWQAGV AFGGMLENWF LCQNDTYKDL LMNALVAQTG PNYDYIPANQ TTVEGNDDQG       120
     VWGLTILDAV ERNFSAPIDG KPGWLAMSQG IFNTMYARWD MQSCNGGLRW QIFTWNSGYN       180
     YKNTISNACL FQIAARLGRY TGNTTYLDVA ERVFDWLVGV GYIVLSEKGN VYDGAKVEDN       240
     CTDITAIEWT YNHGVVLGGL AYMYNATNGS SVWQSRLTSV LGGATAYFFQ DDIMYESACQ       300
     PYKTCNNDQR CFKSIFSRML GFTSVLAPFT SDTIDPLLKA SAMAAAGSCD GGTDGHTCGL       360
     DWQLKTNDGY YGLGEQMSAL EVIQQLLIHE RPAPYRADNG GTSVGDAAAG LNSTTTNVLK       420
     NNLKITGGDR AGAAIVTTIV LGIIIGGAAW MMF                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page