(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE22

CAGLA1_12.PE22       Location/Qualifiers
FT   CDS             70659..73721
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195504"
FT                   /locus_tag="CAGL0M00594g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62347.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124065"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6FF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK73"
FT                   /transl_table=1
FT                   /translation="MMTNGQDQHCLIPKKSRAVKTDKPRPFLCPICSRGFVRQEHLKRH
FT                   QNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRDYKTEQLDKTIGRGKWDEKILNTPD
FT                   VWNNDIVKVKGNKASILPTVDYTMHRQDLVLKSNDGNDSQTGISSQNSITFNNMSVSVG
FT                   SSGVLEYESTSKRSTPGNHSSDSTPTDSSISRLRTEGSYTNTNNADGTLNPVPYHDLDL
FT                   SSSSSLSFATPSYQNTRTSNNPVPIGGGTPLDVNWLNSVLESDNKINELASKSLSPSAT
FT                   LGQKSDKHNNIADFKLSLPESKKNRRYSYPNNLNDTTAKQSNDKNYTGSPLNPNGRMHS
FT                   NGHNNPPSASNATITLNTSAGIENHTINDKDLFRPDLNHNPSLSSLFKTEDPTSSEQPV
FT                   IDIISQLSSEYTSPNDLSFVNLNQPNLGFFTQEWRDLILQKYSLLDNNFPTIKELNEYI
FT                   EQYQKEFHPYFAFLHLHSVQPSLSRISLFLSVAAIGAFYSYNSTHSNLLANLAYGEINQ
FT                   LIKSVKLDSSPLWLVQTMLVLGFYAIFNNDISLVQSASDQFVMIVKIVKSAKINQPLET
FT                   MVVPPTNLFPNPVTKTLTSDQIDAAYRYFITAQSRIHICHSMLFLSNIFPAMSGLEACF
FT                   LSSDVLCGVPCPYEDLYTSKSPGEWYNNVLKNSIEIANSSQLVNLSNGMVSFQTCLEYL
FT                   TTGNHVLYENIKLSLYTLLSLLVSIHEKILLERHKAKTEKDVQYNDTQWKLKQGPLIDS
FT                   VIRKWEILYMKNGGILLPTENNVAKITGSHVMRNNVSFYLFAKLKRCIDLNHVIQKIWM
FT                   RDWTTMNTALEEVIYDKESLQEATDYAISLLRSWASTFTILDDESMQAMKTPMFSMACI
FT                   FSSILIIAEYLRSVERWAKTFNAGDPNAKTMNPTDKILWLKAGRLLKMFQKKLMSSDAK
FT                   KYSEFAGVQKHEMLDITEVDESVLQRAIGLEAKVDETIQMILAASLASKALYIGVRVIG
FT                   DTPIWPISVLFAQGLQSRAVYCVMKDEGVFT"
     MMTNGQDQHC LIPKKSRAVK TDKPRPFLCP ICSRGFVRQE HLKRHQNSHT HEKPFLCLIC        60
     GKCFARKDLV LRHLQKLHRD YKTEQLDKTI GRGKWDEKIL NTPDVWNNDI VKVKGNKASI       120
     LPTVDYTMHR QDLVLKSNDG NDSQTGISSQ NSITFNNMSV SVGSSGVLEY ESTSKRSTPG       180
     NHSSDSTPTD SSISRLRTEG SYTNTNNADG TLNPVPYHDL DLSSSSSLSF ATPSYQNTRT       240
     SNNPVPIGGG TPLDVNWLNS VLESDNKINE LASKSLSPSA TLGQKSDKHN NIADFKLSLP       300
     ESKKNRRYSY PNNLNDTTAK QSNDKNYTGS PLNPNGRMHS NGHNNPPSAS NATITLNTSA       360
     GIENHTINDK DLFRPDLNHN PSLSSLFKTE DPTSSEQPVI DIISQLSSEY TSPNDLSFVN       420
     LNQPNLGFFT QEWRDLILQK YSLLDNNFPT IKELNEYIEQ YQKEFHPYFA FLHLHSVQPS       480
     LSRISLFLSV AAIGAFYSYN STHSNLLANL AYGEINQLIK SVKLDSSPLW LVQTMLVLGF       540
     YAIFNNDISL VQSASDQFVM IVKIVKSAKI NQPLETMVVP PTNLFPNPVT KTLTSDQIDA       600
     AYRYFITAQS RIHICHSMLF LSNIFPAMSG LEACFLSSDV LCGVPCPYED LYTSKSPGEW       660
     YNNVLKNSIE IANSSQLVNL SNGMVSFQTC LEYLTTGNHV LYENIKLSLY TLLSLLVSIH       720
     EKILLERHKA KTEKDVQYND TQWKLKQGPL IDSVIRKWEI LYMKNGGILL PTENNVAKIT       780
     GSHVMRNNVS FYLFAKLKRC IDLNHVIQKI WMRDWTTMNT ALEEVIYDKE SLQEATDYAI       840
     SLLRSWASTF TILDDESMQA MKTPMFSMAC IFSSILIIAE YLRSVERWAK TFNAGDPNAK       900
     TMNPTDKILW LKAGRLLKMF QKKLMSSDAK KYSEFAGVQK HEMLDITEVD ESVLQRAIGL       960
     EAKVDETIQM ILAASLASKA LYIGVRVIGD TPIWPISVLF AQGLQSRAVY CVMKDEGVFT      1020
//

If you have problems or comments...

PBIL Back to PBIL home page