(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE222

CAGLA1_12.PE222      Location/Qualifiers
FT   CDS             complement(556347..557696)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000766" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437870"
FT                   /locus_tag="CAGL0M05159g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="double-stranded RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62546.1"
FT                   /db_xref="GO:0003725"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG059624"
FT                   /db_xref="HOGENOM:HBG203499"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001159"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniParc:UPI00003B70BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM4"
FT                   /transl_table=1
FT                   /translation="MGKIGKVGKASKKKSRLTSELVDLYEKNSTEQVGTYQYSNAIQIE
FT                   HAVHKLVEAYQRILKLSPNIVQYYETLNSLSDPEKVPPQLISLFTRYPLKLAAEIKTLH
FT                   DLNKSTLLDDISGYEAKFDASNREPVLGDLELSDLQDLEDDDIGRLDLDLSVAKSSESS
FT                   ECITSKEKSSKWPPEMPEIKDHVIRARVFMHKSLVNDKVYLNESDIIKSNNERLEFLGD
FT                   SILNTVMTMIIYNKFPSLNEGNLTELRKKLVKNETLREWSELYELPKQLKSNLSPDVDL
FT                   STSKTSADIFEAYIGGLMEDDPKTNLVKIRKWLKKLAKPKIEEAMKTSIQLEPTNNLDM
FT                   NAKRKLYSLIGYAALKLHYHTVQRPTNENPVTIVQCRTGDGTILGVGKARNIKLAGVKA
FT                   AEDVLRKEDVIEKYAKLRASIPREQSVSKNEQPRTTNKEQGEKDICELSG"
     MGKIGKVGKA SKKKSRLTSE LVDLYEKNST EQVGTYQYSN AIQIEHAVHK LVEAYQRILK        60
     LSPNIVQYYE TLNSLSDPEK VPPQLISLFT RYPLKLAAEI KTLHDLNKST LLDDISGYEA       120
     KFDASNREPV LGDLELSDLQ DLEDDDIGRL DLDLSVAKSS ESSECITSKE KSSKWPPEMP       180
     EIKDHVIRAR VFMHKSLVND KVYLNESDII KSNNERLEFL GDSILNTVMT MIIYNKFPSL       240
     NEGNLTELRK KLVKNETLRE WSELYELPKQ LKSNLSPDVD LSTSKTSADI FEAYIGGLME       300
     DDPKTNLVKI RKWLKKLAKP KIEEAMKTSI QLEPTNNLDM NAKRKLYSLI GYAALKLHYH       360
     TVQRPTNENP VTIVQCRTGD GTILGVGKAR NIKLAGVKAA EDVLRKEDVI EKYAKLRASI       420
     PREQSVSKNE QPRTTNKEQG EKDICELSG                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page