(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE225

CAGLA1_12.PE225      Location/Qualifiers
FT   CDS             563163..564308
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195779"
FT                   /locus_tag="CAGL0M05225g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG62549.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B70BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM1"
FT                   /transl_table=1
FT                   /translation="MPKRTLEEWEEDAMESVPYLASDEKGSNYREATQPVILEDSKIVQ
FT                   PKLEVHKTVKPWVHFLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNT
FT                   TRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGT
FT                   TKDIYSKAFNNGQEAPWIHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTYKNSY
FT                   DCLKSILRNEGIYGLYRGLSASYLGSVEGILQWLLYEQLKHLIKKRSIEKFGAHDESTM
FT                   TTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVI
FT                   IKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVIKLLSDI"
     MPKRTLEEWE EDAMESVPYL ASDEKGSNYR EATQPVILED SKIVQPKLEV HKTVKPWVHF        60
     LAGGIGGMAG AVVTCPFDLV KTRLQSDIYQ NMYKSQAEAL MMNTTRPRIV NLTLQAATHF       120
     KETVSIIGNV YRQEGFRSLF KGLGPNLVGV IPARSINFFT YGTTKDIYSK AFNNGQEAPW       180
     IHLMAAATAG WATATATNPI WMVKTRVQLD KAGKTRTYKN SYDCLKSILR NEGIYGLYRG       240
     LSASYLGSVE GILQWLLYEQ LKHLIKKRSI EKFGAHDEST MTTTDKIKQW CQRSGGAGLA       300
     KFMASIVTYP HEVVRTRLRQ SPLENGKVKY TGLVQSFRVI IKEEGLASMY SGLTPHLMRT       360
     VPNSIIMFGT WEVVIKLLSD I                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page