(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE226

CAGLA1_12.PE226      Location/Qualifiers
FT   CDS             complement(564780..565481)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437871"
FT                   /gene_name="MED8"
FT                   /locus_tag="CAGL0M05247g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 8"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62550.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG191925"
FT                   /db_xref="HOGENOM:HBG204194"
FT                   /db_xref="InterPro:IPR019364"
FT                   /db_xref="InterPro:IPR020178"
FT                   /db_xref="UniParc:UPI00003B70BF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJM0"
FT                   /transl_table=1
FT                   /translation="MSGINGALVEDIKPDYSGVPGPALDSVRMRLAQLTHSLRRIRDDL
FT                   SRADLTQWYSLQSQINVTLSQLMSVTSTLQHFEDTLDSTIVYPLPKFPTTSHESLLTTL
FT                   LRKKNIPEVEEWIKDAIEASGVDTNMMRDDEIEKILEKNNEDSKWALEVFAKEFEKRES
FT                   NGDTADDLDVLGNALKPVKTSVRQRAQSPFQVEDVLKYMSRGEVDRGSSSQEGLSTNNE
FT                   QSGDKDIIMAD"
     MSGINGALVE DIKPDYSGVP GPALDSVRMR LAQLTHSLRR IRDDLSRADL TQWYSLQSQI        60
     NVTLSQLMSV TSTLQHFEDT LDSTIVYPLP KFPTTSHESL LTTLLRKKNI PEVEEWIKDA       120
     IEASGVDTNM MRDDEIEKIL EKNNEDSKWA LEVFAKEFEK RESNGDTADD LDVLGNALKP       180
     VKTSVRQRAQ SPFQVEDVLK YMSRGEVDRG SSSQEGLSTN NEQSGDKDII MAD              233
//

If you have problems or comments...

PBIL Back to PBIL home page