(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE227

CAGLA1_12.PE227      Location/Qualifiers
FT   CDS             565772..566170
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000072577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501160"
FT                   /gene_name="AIM4"
FT                   /locus_tag="CAGL0M05269g"
FT                   /product="Altered inheritance of mitochondria protein 4 "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62551.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG124063"
FT                   /db_xref="HOGENOM:HBG512096"
FT                   /db_xref="UniParc:UPI00003B70C0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJL9"
FT                   /transl_table=1
FT                   /translation="MVHSDNNIIKDPKRNGEKPVEMILNGNRKESKRYNEQLSSLEERK
FT                   QKKKLKVVQEDSAYMDQSANQTSSAGLDKDTNELGPKSIFYDPDWNPKGEAPDGFRNVP
FT                   YNPKTFKRLHNQIEEDLGSLSGKLKYPE"
     MVHSDNNIIK DPKRNGEKPV EMILNGNRKE SKRYNEQLSS LEERKQKKKL KVVQEDSAYM        60
     DQSANQTSSA GLDKDTNELG PKSIFYDPDW NPKGEAPDGF RNVPYNPKTF KRLHNQIEED       120
     LGSLSGKLKY PE                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page