(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE229

CAGLA1_12.PE229      Location/Qualifiers
FT   CDS             complement(567906..568646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437872"
FT                   /locus_tag="CAGL0M05313g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62553.1"
FT                   /db_xref="HOGENOM:HBG124064"
FT                   /db_xref="UniParc:UPI00003B70C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL7"
FT                   /transl_table=1
FT                   /translation="MDIEFGSPLKPSKSEDLERAAKQPEDVKNEFHAPVKSFPDLKNIA
FT                   AEADAAMVADLKKKLKGKTKKLKHKDKDRAKRIDQPTLSTATSYSTIHGFSNRRGNMED
FT                   QTSSHRSGSPPFFNNSLSSRGDLQSRQSHKPDSKWTEIDMLDDVRRMAKDKFFEGGFPE
FT                   EFEENLTKNRMSQAKLFQIMRDRNEKLAKTKRRTIRASHVDTRSQSHVEDEGMEPFDQD
FT                   ELESTKQEEKAYVKEIIDTISSLR"
     MDIEFGSPLK PSKSEDLERA AKQPEDVKNE FHAPVKSFPD LKNIAAEADA AMVADLKKKL        60
     KGKTKKLKHK DKDRAKRIDQ PTLSTATSYS TIHGFSNRRG NMEDQTSSHR SGSPPFFNNS       120
     LSSRGDLQSR QSHKPDSKWT EIDMLDDVRR MAKDKFFEGG FPEEFEENLT KNRMSQAKLF       180
     QIMRDRNEKL AKTKRRTIRA SHVDTRSQSH VEDEGMEPFD QDELESTKQE EKAYVKEIID       240
     TISSLR                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page