(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE230

CAGLA1_12.PE230      Location/Qualifiers
FT   CDS             complement(569132..571552)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212424" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348993"
FT                   /locus_tag="CAGL0M05335g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62554.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG027600"
FT                   /db_xref="HOGENOM:HBG559818"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR007582"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B70C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL6"
FT                   /transl_table=1
FT                   /translation="MSGKEKDQKNVKGAAAGAKSGAKAPANGSRPSGQFSASDLNRIVL
FT                   EYLNKKGYHRTEAMLRAESSRTATPVNKNSPANTKDGSLPEPSTVPPAQDANAKPVSNP
FT                   VDSASAKRDASGEVVLKDKVRQDMSPEHYIRAYTMLKNWVDSSLDIYRSELSYIMYPVF
FT                   IYLFLYLVSKDPIYARRFFDKFSSDFRVKHGSEINRLFSVNSVDHIKENEVAKAFNGNR
FT                   YRVTISRAAFYLMLYFLTDNEGVGGSLIIGIINDHIQPNVMDTVRSKDRISDGVEIAAD
FT                   TAGTDGLAEINNAPVTLGPFPKDEEFVKEIETELKIKDDQEKKQIEQSKKGDGSKEGSV
FT                   ASEDVAKEPTADLDDTNDRPTLLQEYRKMNGDESSATPQEESDAAADKQDGKSGDSTKV
FT                   KSEDKKTAVAVVKTEEVAAMMSSPSKDTLPLPPKTALDIKIEIQKVKESRDAIKLDNLQ
FT                   AALPSVCMYTFHNTNRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQF
FT                   DRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNH
FT                   PVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTG
FT                   SSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRI
FT                   KQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDI
FT                   TASINQDIKDYGRRRTIIPTNDLVASFYTKRSPVFKVKFTRSNLALAGGAIRE"
     MSGKEKDQKN VKGAAAGAKS GAKAPANGSR PSGQFSASDL NRIVLEYLNK KGYHRTEAML        60
     RAESSRTATP VNKNSPANTK DGSLPEPSTV PPAQDANAKP VSNPVDSASA KRDASGEVVL       120
     KDKVRQDMSP EHYIRAYTML KNWVDSSLDI YRSELSYIMY PVFIYLFLYL VSKDPIYARR       180
     FFDKFSSDFR VKHGSEINRL FSVNSVDHIK ENEVAKAFNG NRYRVTISRA AFYLMLYFLT       240
     DNEGVGGSLI IGIINDHIQP NVMDTVRSKD RISDGVEIAA DTAGTDGLAE INNAPVTLGP       300
     FPKDEEFVKE IETELKIKDD QEKKQIEQSK KGDGSKEGSV ASEDVAKEPT ADLDDTNDRP       360
     TLLQEYRKMN GDESSATPQE ESDAAADKQD GKSGDSTKVK SEDKKTAVAV VKTEEVAAMM       420
     SSPSKDTLPL PPKTALDIKI EIQKVKESRD AIKLDNLQAA LPSVCMYTFH NTNRDMTSLE       480
     FSDDCRLAAA GFQDSYIKIW SLDGSSLINP KYSSSQFDRF SQDNTCSTLV GHSGTVYSTS       540
     FSPDNMYLVS GSEDKTVKLW SMDTHTALVN YKGHNHPVWD VKFSPLGHYF ASASHDQTAR       600
     LWACDHIYPL RIFAGHTNDV DTVSFHPNGC YVFTGSSDKT CRMWDVSTGD SVRLFLGHTA       660
     PVLSTQVSPD GRWLATGSED GVICLWDIGT GKRIKQMRGH GKNAVHSLSF NKEGNVLISG       720
     GADHSVRVWD VKHGTTEQGP EPEQPFNAHV GDITASINQD IKDYGRRRTI IPTNDLVASF       780
     YTKRSPVFKV KFTRSNLALA GGAIRE                                            806
//

If you have problems or comments...

PBIL Back to PBIL home page