(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE231

CAGLA1_12.PE231      Location/Qualifiers
FT   CDS             572309..573982
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246638" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044620"
FT                   /locus_tag="CAGL0M05357g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAG62555.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG174475"
FT                   /db_xref="HOGENOM:HBG397148"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="UniParc:UPI00003B70C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL5"
FT                   /transl_table=1
FT                   /translation="MLKNFKLGKEKHSRITSADISTPRQDGNNVIKHVKTVPVQVLNQR
FT                   STPSRHASNSSRPQMQSPEKVIKARDSYKAKRANELSFNKGEFFYVTGEDTSYYKASDP
FT                   SAGKNGVVPKSHFDVIDRTRPSSSDALGRSVSTSSRNGEKMGTLYAIVLYDFKAEKSDE
FT                   LDTFVGENLFICAHHNYEWFIAKPIGRLGGPGLVPVGFVSIIDIGTGYATGNDVKEDIA
FT                   SVNLPTVQEWKSNIAKYKASNINLGAVEVPPNGEFGTRQKIQQQIMEEERLRQQQIEAQ
FT                   MTPKVPEPPEIIYASVDAYGLENEKYWYTVSCILDNGRARRLKRYYQDFYDLQVQLLDA
FT                   FPAESGKLRDANGNWTRRIMPYIPGPVPYVTDTITKKRREDLNIYVADLIRLPKYITSS
FT                   RMIQNIFRVKNNGYDTEFDKKDASIHTDNSSTHSKSRTSKIHDKDSTLTGEELNLYEKM
FT                   SELSVSTPGSRPHSRPPSSLPPQLKSIKVKFYYKDDIFALMLPQHISLDELKNKIGPRI
FT                   DTEDFILNIKLKDGLGEEIKTDDQVSYIIQSKQKIAVTDA"
     MLKNFKLGKE KHSRITSADI STPRQDGNNV IKHVKTVPVQ VLNQRSTPSR HASNSSRPQM        60
     QSPEKVIKAR DSYKAKRANE LSFNKGEFFY VTGEDTSYYK ASDPSAGKNG VVPKSHFDVI       120
     DRTRPSSSDA LGRSVSTSSR NGEKMGTLYA IVLYDFKAEK SDELDTFVGE NLFICAHHNY       180
     EWFIAKPIGR LGGPGLVPVG FVSIIDIGTG YATGNDVKED IASVNLPTVQ EWKSNIAKYK       240
     ASNINLGAVE VPPNGEFGTR QKIQQQIMEE ERLRQQQIEA QMTPKVPEPP EIIYASVDAY       300
     GLENEKYWYT VSCILDNGRA RRLKRYYQDF YDLQVQLLDA FPAESGKLRD ANGNWTRRIM       360
     PYIPGPVPYV TDTITKKRRE DLNIYVADLI RLPKYITSSR MIQNIFRVKN NGYDTEFDKK       420
     DASIHTDNSS THSKSRTSKI HDKDSTLTGE ELNLYEKMSE LSVSTPGSRP HSRPPSSLPP       480
     QLKSIKVKFY YKDDIFALML PQHISLDELK NKIGPRIDTE DFILNIKLKD GLGEEIKTDD       540
     QVSYIIQSKQ KIAVTDA                                                      557
//

If you have problems or comments...

PBIL Back to PBIL home page