(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE235

CAGLA1_12.PE235      Location/Qualifiers
FT   CDS             580648..583446
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437873"
FT                   /gene_name="COS111"
FT                   /locus_tag="CAGL0M05445g"
FT                   /product="F-box protein COS111 "
FT                   /protein_id="CAG62559.1"
FT                   /db_xref="HOGENOM:HBG124068"
FT                   /db_xref="HOGENOM:HBG204203"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI00003B70C8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJL1"
FT                   /transl_table=1
FT                   /translation="MQSVNIVSTNYSRYGVSVYDRLYRKDKNVSAKHRPSSTGVYGHDA
FT                   STVDHASRSNNNLNLTRSTSAISESDDVATISTNNSRRSVIKRKYKSLITASSKKLITK
FT                   LYEHGSNSDSFSIFSHKTSQSHHPAQRLGTEEDLIINDLFKRKEISDLPDEVLRNILSN
FT                   VKDDQRTLVNCLYVNKAFYNATKPTLYERPKFTSTYRVAQFVTSIRTNPQNGLYVRELD
FT                   LSKLKNGSLNGKSTSNTGVVADSPDVDEYNPMRTRTGSVTSFTSVTSTANSNTALSITT
FT                   NNKDVALAGWRDWRYRHDPLYSSPVLNSYNAKRTVSRAPSIKSSHSSSSLTLFPGLKSK
FT                   ESFAQLSEGKSSDNGNNGKRQRSNSSVSSITNSLMSSLYNGSHISLNTTLSGSDNNSSK
FT                   TQSKGKSSSSPGNPNDSSGEQDSIISSSSQIDTNTFGMTSSKSTSSTSNWFRMKLHGNG
FT                   TRKLRLRSNKAISSKKDEQQNEESAQTAQKIETPIIKRTEPFSTPHPYTNKFLLKYAQY
FT                   KDLPLGYILHILDHCPYLYILDLSNLTLCTDFEIIEGRRYKGRKQRFGSSRALPVVQES
FT                   VISTDVPNDLDVIYLTDSSKTYEYYDRLRNTNKHKRSSSSNNLWSIPNQGWSDAPAPIG
FT                   SHKNDLRRTHSQTIGRSNVELRKLNASEIFEHIATNQKSAYNTHLRVYMKNVLWCTQDM
FT                   VKSFVLENFDQQAENLGEDKSSEMFIHDMNFSFENSGLNRNFVWTCEGNLQEFIAMVVL
FT                   DEVNRKDDLEIENLFNIKAERILTPTNGPERAPEVHYISNVFTVSYGFQSNKKREMKFR
FT                   VTILKTDTPMYFSIKKLADDYTSVVIKLQTNKNVALHGSETADIITTDQGSVLPEDVPE
FT                   DNNADDTNNGENTIAQPFSNDPKERIERITQEIVARLKDLRGSDLRRNIGENNYVRERF
FT                   LL"
     MQSVNIVSTN YSRYGVSVYD RLYRKDKNVS AKHRPSSTGV YGHDASTVDH ASRSNNNLNL        60
     TRSTSAISES DDVATISTNN SRRSVIKRKY KSLITASSKK LITKLYEHGS NSDSFSIFSH       120
     KTSQSHHPAQ RLGTEEDLII NDLFKRKEIS DLPDEVLRNI LSNVKDDQRT LVNCLYVNKA       180
     FYNATKPTLY ERPKFTSTYR VAQFVTSIRT NPQNGLYVRE LDLSKLKNGS LNGKSTSNTG       240
     VVADSPDVDE YNPMRTRTGS VTSFTSVTST ANSNTALSIT TNNKDVALAG WRDWRYRHDP       300
     LYSSPVLNSY NAKRTVSRAP SIKSSHSSSS LTLFPGLKSK ESFAQLSEGK SSDNGNNGKR       360
     QRSNSSVSSI TNSLMSSLYN GSHISLNTTL SGSDNNSSKT QSKGKSSSSP GNPNDSSGEQ       420
     DSIISSSSQI DTNTFGMTSS KSTSSTSNWF RMKLHGNGTR KLRLRSNKAI SSKKDEQQNE       480
     ESAQTAQKIE TPIIKRTEPF STPHPYTNKF LLKYAQYKDL PLGYILHILD HCPYLYILDL       540
     SNLTLCTDFE IIEGRRYKGR KQRFGSSRAL PVVQESVIST DVPNDLDVIY LTDSSKTYEY       600
     YDRLRNTNKH KRSSSSNNLW SIPNQGWSDA PAPIGSHKND LRRTHSQTIG RSNVELRKLN       660
     ASEIFEHIAT NQKSAYNTHL RVYMKNVLWC TQDMVKSFVL ENFDQQAENL GEDKSSEMFI       720
     HDMNFSFENS GLNRNFVWTC EGNLQEFIAM VVLDEVNRKD DLEIENLFNI KAERILTPTN       780
     GPERAPEVHY ISNVFTVSYG FQSNKKREMK FRVTILKTDT PMYFSIKKLA DDYTSVVIKL       840
     QTNKNVALHG SETADIITTD QGSVLPEDVP EDNNADDTNN GENTIAQPFS NDPKERIERI       900
     TQEIVARLKD LRGSDLRRNI GENNYVRERF LL                                     932
//

If you have problems or comments...

PBIL Back to PBIL home page