(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE237

CAGLA1_12.PE237      Location/Qualifiers
FT   CDS             585392..586672
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437875"
FT                   /locus_tag="CAGL0M05489g"
FT                   /product="Similar to uniprot|P38130 Saccharomyces
FT                   cerevisiae YBR205w KTR3"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62561.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI00003B70CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK9"
FT                   /transl_table=1
FT                   /translation="MGAVKKKLMPKSAMFVRKYEKTIRVGFASFLMALTVLFLMHKPDA
FT                   GTTAMAPQQTMAGFTSVVKNGQPGYVIPASDLLQDVKEHPLDDGVKEKAAFITLARNGD
FT                   LWSLVNTIRHVEDRLNHRYHYDWVFLNDKGFTDEFIRLTSALVSGKAKYGKVPKEHWEV
FT                   PSHIDKEKYEISRRKMVLDKVPYGDSTPYRHMCRYQSGLFYRHELVQEYDYYWRVDTDI
FT                   TVFCNFQYDIFKFLRQNKKKYGFVISLTEYEETIPTLWATVKEFMKKYPQHIHKNNFLN
FT                   FISDDGGETYNGCHFWTNFEVGDLNFWRSQAYTDFFNFLDQKGGFYYERWGDAPVHSIA
FT                   AALLLDKDEIHFFDGFGYHHPDFQSCPHEEEVRLQNKCTCNFSKDKIWMTYYFCNLRYF
FT                   EAKEIGLPPKIEANLDEEYKKKLKVSS"
     MGAVKKKLMP KSAMFVRKYE KTIRVGFASF LMALTVLFLM HKPDAGTTAM APQQTMAGFT        60
     SVVKNGQPGY VIPASDLLQD VKEHPLDDGV KEKAAFITLA RNGDLWSLVN TIRHVEDRLN       120
     HRYHYDWVFL NDKGFTDEFI RLTSALVSGK AKYGKVPKEH WEVPSHIDKE KYEISRRKMV       180
     LDKVPYGDST PYRHMCRYQS GLFYRHELVQ EYDYYWRVDT DITVFCNFQY DIFKFLRQNK       240
     KKYGFVISLT EYEETIPTLW ATVKEFMKKY PQHIHKNNFL NFISDDGGET YNGCHFWTNF       300
     EVGDLNFWRS QAYTDFFNFL DQKGGFYYER WGDAPVHSIA AALLLDKDEI HFFDGFGYHH       360
     PDFQSCPHEE EVRLQNKCTC NFSKDKIWMT YYFCNLRYFE AKEIGLPPKI EANLDEEYKK       420
     KLKVSS                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page