(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE239

CAGLA1_12.PE239      Location/Qualifiers
FT   CDS             complement(588667..594171)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000251581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437877"
FT                   /locus_tag="CAGL0M05533g"
FT                   /product="Similar to uniprot|P32528 Saccharomyces
FT                   cerevisiae YBR208c DUR1 urea amidolyase "
FT                   /function="ATP binding"
FT                   /function="biotin binding"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /function="lyase activity"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="protein folding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG62563.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG304781"
FT                   /db_xref="HOGENOM:HBG567256"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="UniParc:UPI00003B70CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK7"
FT                   /transl_table=1
FT                   /translation="MTATNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPE
FT                   DPAWISVATESLLEQQWQLLQSRHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYM
FT                   PTRDSTVVELLKQAGAIIIGKTNLDQFATGLVGTRSPYGRTPCVFSDKHVSGGSSAGSA
FT                   SVVARGIVPIALGTDTAGSGRVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSM
FT                   NLSDAEKCLKIMTKLDIENDEYSRSFPANPLQSFNKNLTVAIPKNVMWYGEKENPLLYD
FT                   RAIDNFKQLGAQIKIIDFEPLLELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVY
FT                   GIIKSATKFDAADAFEYEYKRQGILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILV
FT                   NSRQGTWTNFVNLADLSALAIPVGFRSDGLPNGVTLIAKKFEDYALLQLAKRFLAQLYP
FT                   SGTRPYGMFLDRYVGLKDDSLEGPIVSSDDSIVLAVVGAHLRGLPLHWQLEKVNATFIC
FT                   STKTAKKYELYALPKNGPVLKPGLRRITSGTGSQIELELYSVPKEKFGEFISFVPEPLG
FT                   IGSVELENGKWVKSFICEESGYNSTGSIDISHYGGFRAYIESIIPSNESKKGHFKTVLV
FT                   ANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKI
FT                   ISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKS
FT                   AGVPLVPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVK
FT                   HQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEETPA
FT                   PNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEM
FT                   VTGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVYAENPLKDFRPSPGELVDVQFP
FT                   NDCRVDTWVKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKALNETKIYGCVTNVDYL
FT                   KSLISSEMFRNAQLSTNYLNTYEYSPSAVEIIEPGALTTIQDYPGRVNYWRIGVPPCGP
FT                   MDNYSFRLANRIVGNDERTPGIEITLTGPTIKFYSDSLVSIAGGEVCCKLDEKKIPMFE
FT                   PISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKYMGSFSTFTMGNLGGFNGRALKRGDV
FT                   LSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDGVWTIGVLAGPHGAPDIFESEGMME
FT                   FFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGLHPSNTHDYVYSLGAINFTGDEPV
FT                   IITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINFTPIDWQSARNLKENQDVIINDM
FT                   SSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYRQAGDRYILIEYGDDIFELNLC
FT                   YRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQKELLKTLIAYEEQLPQEKNW
FT                   SVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNVDFVAEVNNLTHDDIRQLIY
FT                   TTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTKRGVVGIGGSYMCIYAADS
FT                   PGGYQLVGRTIPIWDRLMLQSKKDEPWLLSPFDQIEFYPVSEEQIDEYTDEWDNGNYKI
FT                   DVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQEANADLKQTTTEVIEQ
FT                   NILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIVSSSVVGKLKKFL
FT                   FKNGDMVDAGDPVAIIQCL"
     MTATNICPSI GWSIQDWIDF HFKSTPKDSY ESLLELVKNQ RIAPEDPAWI SVATESLLEQ        60
     QWQLLQSRHE KEKLPLYGVP IAVKDNIDAK GFPTTAACPS FSYMPTRDST VVELLKQAGA       120
     IIIGKTNLDQ FATGLVGTRS PYGRTPCVFS DKHVSGGSSA GSASVVARGI VPIALGTDTA       180
     GSGRVPAALN NIIGLKPTRG IFSCSGVVPA CKSLDCVSVF SMNLSDAEKC LKIMTKLDIE       240
     NDEYSRSFPA NPLQSFNKNL TVAIPKNVMW YGEKENPLLY DRAIDNFKQL GAQIKIIDFE       300
     PLLELARCLY EGTWVAERYA ATRKFLETSP QQSTLDPVVY GIIKSATKFD AADAFEYEYK       360
     RQGILRKVEV LLQDIDVLCV PTCPLNPSFE EVDKEPILVN SRQGTWTNFV NLADLSALAI       420
     PVGFRSDGLP NGVTLIAKKF EDYALLQLAK RFLAQLYPSG TRPYGMFLDR YVGLKDDSLE       480
     GPIVSSDDSI VLAVVGAHLR GLPLHWQLEK VNATFICSTK TAKKYELYAL PKNGPVLKPG       540
     LRRITSGTGS QIELELYSVP KEKFGEFISF VPEPLGIGSV ELENGKWVKS FICEESGYNS       600
     TGSIDISHYG GFRAYIESII PSNESKKGHF KTVLVANRGE IAVRIIKTLK SMQIKSLAIY       660
     SATDKYSQHV LDVDMAQALD GHTVEETYLH VEKIISIAKK YDVDAIIPGY GFLSENASFA       720
     DRCEQEGIQF IGPRGETIRK LGLKHSAREV AKSAGVPLVP GSPLVKNADE AFTIAKNIGY       780
     PVMVKSTAGG GGIGLQKVDN EQDMRKAFET VKHQGSSYFG DSGVFMEKFI DNARHVEVQI       840
     MGDGKGKTLA LGERDCSLQR RNQKVIEETP APNLPRETRQ KMLTAAERLG AYLNYRGAGT       900
     VEFIYDEQRD QFYFLEVNTR LQVEHPITEM VTGLDLVEWM IKISAGVMPS LDEFNISQNG       960
     ASIEVRVYAE NPLKDFRPSP GELVDVQFPN DCRVDTWVKK GTKISPEFDP TLAKIIVHGK      1020
     DRNEAILKMK KALNETKIYG CVTNVDYLKS LISSEMFRNA QLSTNYLNTY EYSPSAVEII      1080
     EPGALTTIQD YPGRVNYWRI GVPPCGPMDN YSFRLANRIV GNDERTPGIE ITLTGPTIKF      1140
     YSDSLVSIAG GEVCCKLDEK KIPMFEPISV KTGSVLSIGK IVKGSRAYLA IRGGIDVPKY      1200
     MGSFSTFTMG NLGGFNGRAL KRGDVLSLPQ QFDSEHGIPS PCFSPEKAPI YVRPDIPNDG      1260
     VWTIGVLAGP HGAPDIFESE GMMEFFKSEW KVHYNSNRFG VRLIGPKPKW SRTDGGEGGL      1320
     HPSNTHDYVY SLGAINFTGD EPVIITCDGP SLGGFVCQAV VSEAEMWKVG QLKPGDTINF      1380
     TPIDWQSARN LKENQDVIIN DMSSCALQKL SDQPLLKSPE DPILFQKDGQ ELQSPKVVYR      1440
     QAGDRYILIE YGDDIFELNL CYRIKSLIDI ISQRNTKGIK EMSQGVRSVL VEYDGYEISQ      1500
     KELLKTLIAY EEQLPQEKNW SVKSRIFRLP MAFEDKETLA CVKRYQETIR SKAPWLPNNV      1560
     DFVAEVNNLT HDDIRQLIYT TRYMVLGVGD VFLGSPCAIP LDPRNRLLGS KYNPSRTFTK      1620
     RGVVGIGGSY MCIYAADSPG GYQLVGRTIP IWDRLMLQSK KDEPWLLSPF DQIEFYPVSE      1680
     EQIDEYTDEW DNGNYKIDVD DVVFDHGSYL KWVQDNIEAI EEHQRAQRGD NYSKFAQKIQ      1740
     EANADLKQTT TEVIEQNILE DDCEYIFSEY AGRFWKPIVE IGASIEKDQG VAVIEAMKTE      1800
     MIVSSSVVGK LKKFLFKNGD MVDAGDPVAI IQCL                                  1834
//

If you have problems or comments...

PBIL Back to PBIL home page