(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE24

CAGLA1_12.PE24       Location/Qualifiers
FT   CDS             complement(76881..78077)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216214" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436687"
FT                   /gene_name="FPR4"
FT                   /locus_tag="CAGL0M00638g"
FT                   /product="FK506-binding protein 4 "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG62349.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG396046"
FT                   /db_xref="HOGENOM:HBG434444"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI00003B6FF8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK71"
FT                   /transl_table=1
FT                   /translation="MSDMLPLAMYALNVEPYTHTPAVLLDTPVTVRITMAAIDPEPFDE
FT                   DKKPSTLRIIRRNPVYLDAGEVDEEKLIEELEGDEAAEDGDEASDDDKEEEDEDEDVDE
FT                   DDEDDDEDDDGEDEYEECVVVTLSPETRCQQAIDITIAPEEDVQFLVTGSYTISLTGNY
FT                   VKHPFDEPLEDLYSDEDSEEYSDDELDQEIEEDDELDHDEASSEESDEDQEFYDAISEG
FT                   DEDIDEQLAKLEETSDVEAHLEDLIAKDNKKKRKQEQLDEQPETKKSKKTKDEKNTKAT
FT                   ENEKKNKAQVLEGGVIIEDRKIGEGPKAKKGSKVGMRYIGKLKNGKVFDKNTSGKPFYF
FT                   KLHRGEVIKGWDIGVTGMAIGGERRIVIPAPYAYGKQTLPGIPANSELTFDVKLVSLK"
     MSDMLPLAMY ALNVEPYTHT PAVLLDTPVT VRITMAAIDP EPFDEDKKPS TLRIIRRNPV        60
     YLDAGEVDEE KLIEELEGDE AAEDGDEASD DDKEEEDEDE DVDEDDEDDD EDDDGEDEYE       120
     ECVVVTLSPE TRCQQAIDIT IAPEEDVQFL VTGSYTISLT GNYVKHPFDE PLEDLYSDED       180
     SEEYSDDELD QEIEEDDELD HDEASSEESD EDQEFYDAIS EGDEDIDEQL AKLEETSDVE       240
     AHLEDLIAKD NKKKRKQEQL DEQPETKKSK KTKDEKNTKA TENEKKNKAQ VLEGGVIIED       300
     RKIGEGPKAK KGSKVGMRYI GKLKNGKVFD KNTSGKPFYF KLHRGEVIKG WDIGVTGMAI       360
     GGERRIVIPA PYAYGKQTLP GIPANSELTF DVKLVSLK                               398
//

If you have problems or comments...

PBIL Back to PBIL home page