(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE240

CAGLA1_12.PE240      Location/Qualifiers
FT   CDS             complement(596196..597707)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501161"
FT                   /gene_name="DEM1"
FT                   /locus_tag="CAGL0M05577g"
FT                   /product="Defects in morphology protein 1, mitochondrial "
FT                   /biological_process="regulation of cell shape"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62564.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008360"
FT                   /db_xref="HOGENOM:HBG124070"
FT                   /db_xref="HOGENOM:HBG204182"
FT                   /db_xref="InterPro:IPR016610"
FT                   /db_xref="InterPro:IPR019190"
FT                   /db_xref="UniParc:UPI00003B70CD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJK6"
FT                   /transl_table=1
FT                   /translation="MTLRDVEKLRLWRLKIFRNQQPILRAKPPHASRKTQYLFQKIDNV
FT                   KSQFGTDGKGDLLWQRDGMNPYHDLYDPGDLKTHRLSVTKLLTKSWCELRFAYDLYSRL
FT                   PLFREAHLAAGERTHQKLENSEHTPVIRPQDIPQFSETVEIVEDDLHVLAASWAETITR
FT                   LIHLFSSGDAREILCHGYLNKETNQLYDPMETEVWDPSQHILISGIIDHLTLTSKNGNL
FT                   PLNNHHRSIDDSIAKLKNTRNEFAKNGLTIQISDVKTRTRKFIPPQESVQNATKLQLMY
FT                   YRHFLLSLGTDSDNTYEMLLYNARIRGVDVDQPLNPANCLLIMIQMDGFVGDFVKLQNG
FT                   DGFQFPKFDNAPISHSFTLADAKHHQFLQNINSHELAGQLLNGTFAKPITLRYFAMRLA
FT                   QMYSMLTPLISEKLKVEYYHNNECFQEVEFVNDKKSLGESCRSASSFWFGKRAIEPVEA
FT                   TTFNYNQYCKHCDYRDHCAWIKDSLAKSTKLGDELTQIARRIHNI"
     MTLRDVEKLR LWRLKIFRNQ QPILRAKPPH ASRKTQYLFQ KIDNVKSQFG TDGKGDLLWQ        60
     RDGMNPYHDL YDPGDLKTHR LSVTKLLTKS WCELRFAYDL YSRLPLFREA HLAAGERTHQ       120
     KLENSEHTPV IRPQDIPQFS ETVEIVEDDL HVLAASWAET ITRLIHLFSS GDAREILCHG       180
     YLNKETNQLY DPMETEVWDP SQHILISGII DHLTLTSKNG NLPLNNHHRS IDDSIAKLKN       240
     TRNEFAKNGL TIQISDVKTR TRKFIPPQES VQNATKLQLM YYRHFLLSLG TDSDNTYEML       300
     LYNARIRGVD VDQPLNPANC LLIMIQMDGF VGDFVKLQNG DGFQFPKFDN APISHSFTLA       360
     DAKHHQFLQN INSHELAGQL LNGTFAKPIT LRYFAMRLAQ MYSMLTPLIS EKLKVEYYHN       420
     NECFQEVEFV NDKKSLGESC RSASSFWFGK RAIEPVEATT FNYNQYCKHC DYRDHCAWIK       480
     DSLAKSTKLG DELTQIARRI HNI                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page