(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE243

CAGLA1_12.PE243      Location/Qualifiers
FT   CDS             complement(601941..603266)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200927" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501162"
FT                   /locus_tag="CAGL0M05621g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62566.1"
FT                   /db_xref="HOGENOM:HBG433971"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI00003B70CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK4"
FT                   /transl_table=1
FT                   /translation="MKKELKLLIYANFMLVVFILYYTFDLLMLCIDDTFQDALLDFELN
FT                   PPRDRVTGLEVHDGKPELIPKIIHQTYKTEDIPEQWKESQKKCIDLHPDYEYILWTDEM
FT                   ALKFIKEEYAWFLDTFENYKYPIQRADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVP
FT                   AFVRKTSPLGVSNNVMGSVPRHPFYLKLLNSLKHYDKYWFIPYLTIMGSTGPLFVSVIW
FT                   KQYKRWGVPENGVVRIMQPADYKKHTYSFFSISKGSSWHMDDAVFMKSLENHILSCVVA
FT                   GFIVGFIILYGEYVFYCWLCASWLGSSNDPEAESQDDEDDFIYNKGSQYYQQGHGSIFL
FT                   GTSISPLRKLNKSLFSTLYTKLVPSSSSSSASACSVSEKYSTPKLSRSVAEYYSLRKEN
FT                   SVHFNSPTPKGKRSRKDSNVRFTNFLLSDIEKLDPNVEDLTN"
     MKKELKLLIY ANFMLVVFIL YYTFDLLMLC IDDTFQDALL DFELNPPRDR VTGLEVHDGK        60
     PELIPKIIHQ TYKTEDIPEQ WKESQKKCID LHPDYEYILW TDEMALKFIK EEYAWFLDTF       120
     ENYKYPIQRA DAIRYFILSH YGGIYIDLDD GCERRLDPLL KVPAFVRKTS PLGVSNNVMG       180
     SVPRHPFYLK LLNSLKHYDK YWFIPYLTIM GSTGPLFVSV IWKQYKRWGV PENGVVRIMQ       240
     PADYKKHTYS FFSISKGSSW HMDDAVFMKS LENHILSCVV AGFIVGFIIL YGEYVFYCWL       300
     CASWLGSSND PEAESQDDED DFIYNKGSQY YQQGHGSIFL GTSISPLRKL NKSLFSTLYT       360
     KLVPSSSSSS ASACSVSEKY STPKLSRSVA EYYSLRKENS VHFNSPTPKG KRSRKDSNVR       420
     FTNFLLSDIE KLDPNVEDLT N                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page