(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE244

CAGLA1_12.PE244      Location/Qualifiers
FT   CDS             603919..604449
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190729" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044622"
FT                   /locus_tag="CAGL0M05643g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62567.1"
FT                   /db_xref="HOGENOM:HBG174727"
FT                   /db_xref="HOGENOM:HBG396998"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR017789"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="UniParc:UPI00003B70D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK3"
FT                   /transl_table=1
FT                   /translation="MIRNILRRSAARVRIPVTSATCASRLVMSIRLATSTRYYSNGNEG
FT                   GPAMTNGVQIPKEVLELPLQQYHQHSESFLEGLFDNLEELSENYPQHIPEVEYSHGVMS
FT                   LTVAGVGTYVINKQPPNKQIWLSSPNSGPNRFDLYKGEWISLRNNETLLSVLDKELHDA
FT                   LPNDAEFKVESDQ"
     MIRNILRRSA ARVRIPVTSA TCASRLVMSI RLATSTRYYS NGNEGGPAMT NGVQIPKEVL        60
     ELPLQQYHQH SESFLEGLFD NLEELSENYP QHIPEVEYSH GVMSLTVAGV GTYVINKQPP       120
     NKQIWLSSPN SGPNRFDLYK GEWISLRNNE TLLSVLDKEL HDALPNDAEF KVESDQ           176
//

If you have problems or comments...

PBIL Back to PBIL home page